SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000708 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000708
Domain Number 1 Region: 47-158
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000376
Family Deoxycytidylate deaminase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000708   Gene: ENSSSCG00000000667   Transcript: ENSSSCT00000000723
Sequence length 199
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:65607546:65616194:1 gene:ENSSSCG00000000667 transcript:ENSSSCT00000000723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLLMKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVANFLRGNPNLSLRIFTARLYFCDGYK
AEPEGLRRLHRAGVQIAIMTFKEDYFYCWNTFVENRERSFKAWEGLHENSVRLTRQLRRI
LLPLYEVDDLRDAFRTLGL
Download sequence
Identical sequences ENSSSCP00000000708 ENSSSCP00000000708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]