SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001161 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001161
Domain Number 1 Region: 57-535
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-160
Family ALDH-like 0.000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001161   Gene: ENSSSCG00000001090   Transcript: ENSSSCT00000001186
Sequence length 537
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:20501783:20525997:1 gene:ENSSSCG00000001090 transcript:ENSSSCT00000001186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFRLRGCLTLHLPTAPAIRGLRPRADCLVATTRPSPGPAPIRRYARGTEGLSSALLR
TDGFVGGRWLSAASTFPVYDPASGAELGLVADCGVSEARAAVRAAYEAFCTWKGVSAKER
SSFLRKWYDLMIQNKDDLAKIITAESGKPLKEAQGEILYSANFLEWCSEEARRVYGDVIY
TPAKERRALVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AQLANQAGIPPGVYNVIPCSQKKAMEVGEALCTDPLVSKISFTGSTATGKVLLHHAANSV
KRVSMELGGHAPFIVFDSANVDQAVAGAMVSKFRNSGQTCVCSNRFLVQRGIHDSFVKKF
AEAIKTNLCVGNGFEERTTQGPLINEKAVEKVEKHVIDAISKGATVVTGGKRHQVGKNFF
EPTLLSNVTQEMLCSREETFGPLAPVIKFDTEEEAVAIANAANVGWQVSRYFYSQDLAQI
WRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCFGGL
Download sequence
Identical sequences ENSSSCP00000001161 ENSSSCP00000001161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]