SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001850 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001850
Domain Number 1 Region: 10-355
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.47e-131
Family Calpain large subunit, catalytic domain (domain II) 0.00000000269
Further Details:      
 
Domain Number 2 Region: 361-519
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 9.03e-54
Family Calpain large subunit, middle domain (domain III) 0.00000181
Further Details:      
 
Domain Number 3 Region: 529-707
Classification Level Classification E-value
Superfamily EF-hand 4.67e-45
Family Penta-EF-hand proteins 0.00000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001850   Gene: ENSSSCG00000001698   Transcript: ENSSSCT00000001897
Sequence length 709
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:44993274:45008443:1 gene:ENSSSCG00000001698 transcript:ENSSSCT00000001897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AETSITNKGIAAHITQSRLRAKGVGQQHNAENYNNQSFEELRAICLRKGLLFEDPLFPAE
PSSLGFRELGPNSKNVQNISWQRPSQITSNPQFIVNGVSPTDICQGVLGDCWLLAAIGSL
TVYPKLFHRVVPKGQSFKKNYAGIFHFQIWQFGQWMDVVVDDRLPTKNGKLVFVHSAERT
EFWSALLEKAYAKLNGSYEALSGGNTMEGFEDFTGGVTQSFQLQTPPQNLLRMLRKGIER
SSLMKKKTNVTSNSDLESLTQRMLVKGHAYSVTGLQDIWYHGKTVTLIRVRNPWGRIEWN
GAWSDNAKEWEEVSPDFQRQMLHRKEDGEFWMSYQDFLDNFTLLEICNLMPDTLSDYKSC
WHTTFYEGSWRRGSTAGGCRSHLDTFWTNPQFKLSLPEEDDDDPEAEEAVCTCLVALMQK
NWRRGRPHGAQLQTIGFVIYTIPKEFQNLQDIHLKRDFFEKYQDLGFSEIFTNSREVSNH
LRLPPGEYIIIPSTFEPHKDADFLLRVFSEKHSESWELDEANCTQLLQEETISENEIDQN
FLHLFQIVAGGEDKEIGVYELQKLLNKVASKFRHLKTKGFSLDVCRCMINLLDKDSSGKL
GLQEFQILWRKIKKWTDIFQECDQDHSGTLNSYEMRLAIERAGIKLSNKVTQVLVARYAN
DDMILDFDSFISCFLRLKAMFTYFLTMDPNNTGQICLNLNQWLQITMWG
Download sequence
Identical sequences ENSSSCP00000001850 ENSSSCP00000001850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]