SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002057 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002057
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.18e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.000000441
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.8e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000217
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002057   Gene: ENSSSCG00000001882   Transcript: ENSSSCT00000002107
Sequence length 389
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:62949965:62956276:-1 gene:ENSSSCG00000001882 transcript:ENSSSCT00000002107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNEACGELVFGGCVEKSPVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGAQPPQEPLALVFRFGMTGSFQLVPRDALPPHAHLRFYTAPPSPQLALCFVDIRRF
GRWELGGEWDPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILHRLRIPPFEKARTVLEALQRHRLSPELTLSQKIKAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESREEDFAAFRAWLRCYGTPGMNSLRDRHGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQQGPEDRVEDPTLQNKATLRTRRTQRGLEQSTAQQPKGTSLQQDPETPLVPEKGKRR
RRQATSGRRRPQKITGDTPSLEPEGTSAS
Download sequence
Identical sequences F1SJ67
ENSSSCP00000002057 ENSSSCP00000002057 9823.ENSSSCP00000002057 XP_001924578.1.46622 XP_005666203.1.46622 XP_013833516.1.46622 XP_013833518.1.46622 XP_020954687.1.46622 XP_020954688.1.46622 XP_020954689.1.46622 XP_020954690.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]