SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003435 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003435
Domain Number 1 Region: 25-487
Classification Level Classification E-value
Superfamily ALDH-like 4.58e-90
Family ALDH-like 0.00000278
Further Details:      
 
Domain Number 2 Region: 498-768
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-42
Family ALDH-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003435   Gene: ENSSSCG00000003168   Transcript: ENSSSCT00000003518
Sequence length 802
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:50258234:50275377:1 gene:ENSSSCG00000003168 transcript:ENSSSCT00000003518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETCTGSRASEIFTTLEYGPVPESHACALAWLDTQDRLLGHYVNGKWLKPEHRSSVPCQ
DPITGEKLASCLQAQTEDVAEAVEAARASLENWSTLPGAFRAQYLTRLAKMIQKHQRLFW
TLESLVTGRAVREIRDRDVPLAQQLLQYHAIQAHTQEEALAGWEPTGVIGLVLPPTFSFL
EMMWRICPALAVGCTVVVLVPPASPTPLLLAQLAGELGQFPGILNVISGPAVLGLVLSSQ
PGVQKVAFCGAVEEGRALRRFLAGQGPELGLALGAESLLLMTEAADVDSAVEGVVDAAWS
DRSLGGLRLLIQESVWDETMRRLQARMGRLRGGRGLDGAVDMGARGTAARDQAQRYVSEA
QRQGAQVFQAGSVPSDSPFFPPTLISDLPPASPCTQAEVPWPLVVASPFRTAKEALALAN
GTPGGGSASVWSERLGQALELAYGLRMGTVWINAHGLRDPAVPTGGCKESGSSWHGGLDG
LYEYLRPSGTPARLPYLSENLNYDTFGLAVPSTLPAGPETGPSPAPPYGLFVGGRFQAPG
ARSSRPIWDSHGKLHGYVAEGGAKDIRGAVEAAHQAAPGWVGQSPGARAALLWALAAALQ
RRESTLASRLERHGVELQVAKAEVELSVRRLRAWGARVQAQGCTLQVAELRGPVLRLREP
LGVLAIVCPDEWPLLAFVSLLAPALAHGNTVVLVPSGACPIPALEVCQDMAALLPAGLVN
VVTGDPDHLTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEAE
GAGPELGLRAARTKALWLPMGD
Download sequence
Identical sequences ENSSSCP00000003435 9823.ENSSSCP00000003435 ENSSSCP00000003435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]