SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004026 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004026
Domain Number 1 Region: 250-341
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-33
Family TAFH domain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 654-702
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000193
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004026   Gene: ENSSSCG00000003718   Transcript: ENSSSCT00000004118
Sequence length 864
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:103817488:103934630:1 gene:ENSSSCG00000003718 transcript:ENSSSCT00000004118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPTGAAPPASVGASGTVTMAPAAALPVRVESTPVALGAVTKAPVSVCVESTASQ
PLRSPIGTLVTKVAPVSALPKLSSGPRLPAPQIVAVKAPNTTTIQLPANLQLPPGTVLIK
SNSGQLMLVSPQQAVTRTEATGNITSRPAVPMNTQTVKICTMPNSSSQLIKKVAVAPVKQ
LAQVGTTVVTTVPKPSPVQSAAVPTTVTPVKPLNTVTTLKPSSLGASSAPSNEPDLKAEN
SAAAQANLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEAEEF
TRQLYVELKSSPQPHLVPFLKKSVIALRQLLPNSQSFIQQCVQQTSSEVVIATCTTTVTP
SPVVTTAVSSIQPEKSIVGSEAATPGTVSVQTLNPLAGPGAAKTGVVTLHSVGPAAVPGG
TTAGTVVLQTPKPLVTSLQNTVTTVSLQPEKPVVSGAAVGAAVTLALPSVTFGETSAAAL
CLPSVKPVVTSAGTTSDKPVIGAPVQIKLAQPGPILAQPAGIPQAVKVKQLVVQQPSGGL
AKQVTTLSHSSALTIQKSGQKTVTVSTAIPASQFPQASILKQITLPGNKILSLQSPIQKN
KIKENGTTSFRDEDDINDVTSMAGVNLSEENACILAANSELVGTLVQSCKDEPFLFIGAL
QKRILDIGKKHDITEFNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILSN
DTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQ
IQHRDANLTALAAIGPRKKRPLESGSGSEGLKDNLFASGTSSLTATKQLLRPRITRICLR
DLIFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences F1SBA4
ENSSSCP00000004026 XP_003127923.1.46622 ENSSSCP00000004026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]