SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004335 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004335
Domain Number 1 Region: 961-1175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-104
Family Thrombospondin C-terminal domain 0.00000000471
Further Details:      
 
Domain Number 2 Region: 31-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-38
Family Laminin G-like module 0.0000101
Further Details:      
 
Domain Number 3 Region: 838-960
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-35
Family TSP type-3 repeat 0.000000463
Further Details:      
 
Domain Number 4 Region: 769-840
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.97e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 497-548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.88e-16
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 440-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.0000908
Further Details:      
 
Domain Number 7 Region: 697-781
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000262
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 324-382
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000136
Family VWC domain 0.0058
Further Details:      
 
Domain Number 9 Region: 387-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 553-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000973
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004335   Gene: ENSSSCG00000004012   Transcript: ENSSSCT00000004436
Sequence length 1176
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:1590789:1616464:-1 gene:ENSSSCG00000004012 transcript:ENSSSCT00000004436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLEGSRMLWPLLLLASGAWSSARAGDQDEDTAFDLFSVSNINRKTIGAKQFRGPDPSVPA
YRFVRFDYIPPVGAEPLGRIAEAMRRKEGFFLTASLKQDRKSRGTLLALEGPGATRRQFE
IVSNGPADTLDLTYWVDGAQHVISLEDVGLADAQWKNVTVQVTGETYSLYVGCDLMDSFT
LDEPFYEQLKTEQSRMYVAKGSARESHFRGLLQNVFLVFENSVEDLLSKKGCRQSQGAEA
NAISENTETLHLSPPVSTGHVGLGAEKGREVCEHSCEELGSMIQELSGLHVIVSQLHENL
RKVSNDNQFLWELIGGPPKTRNVSACWQDGRFFAENETWVVDSCTKCTCRKFKTVCHQIT
CPPATCADPAFVDGECCPSCFSDGEEGWSPWAEWTECSATCGPGTQQRGRSCDVTSNTCL
GPSIQTRACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGRGC
KGSGRETRACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGD
VKEQQMCNKRSCPVDGCLSNPCFPGASCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAV
VTDVCFTTSKAHRCVNTDPGFHCLPCPPRYKGSQPFGVGLEAARTEKQVCEPENPCEDKT
HNCHRHAECVYLGHFSDPMFKCECRTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCI
KDNCPLLPNSGQEDFDKDGTGDACDDDDDNDGVSDEKDNCQLLFNPRQFDYDKDEVGDRC
DNCPYVHNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCD
NCPLVHNPDQTDVDNDLVGDQCDNNEDVDEDGHQNNQDNCPYISNANQADHDHDGKGDAC
DSDDDNDGVPDDRDNCRLVANPDQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENNAISE
TDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYV
NTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGE
HLRNALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMAD
SGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
Download sequence
Identical sequences ENSSSCP00000004335 ENSSSCP00000004335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]