SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004525 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004525
Domain Number 1 Region: 33-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000009
Family Fibronectin type I module 0.018
Further Details:      
 
Domain Number 3 Region: 197-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000128
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004525   Gene: ENSSSCG00000004192   Transcript: ENSSSCT00000004631
Sequence length 349
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:35133813:35137139:-1 gene:ENSSSCG00000004192 transcript:ENSSSCT00000004631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATGLSPVRCAFVLLLALCSRPASGQDCSGQCQCAAGKAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGTVYRSGESFQSSC
KYQCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDHTVVGPALA
AYRLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKSMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences F1S3P6
ENSSSCP00000004525 ENSSSCP00000004525 NP_998998.2.46622 9823.ENSSSCP00000004525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]