SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004999 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004999
Domain Number 1 Region: 744-1077
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-111
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000386
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 4.58e-48
Family USP8 N-terminal domain-like 0.000000399
Further Details:      
 
Domain Number 3 Region: 178-322
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 7.13e-34
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.000000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004999   Gene: ENSSSCG00000004639   Transcript: ENSSSCT00000005124
Sequence length 1089
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:134748670:134815999:-1 gene:ENSSSCG00000004639 transcript:ENSSSCT00000005124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFLSILGPGNIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEKEQLQRQKRQEAGIEDGGTSAKSSLESVLDSKDKTRKINGEKSEKNETTEK
GAITAKELYTMMMDKNISLIIMDARRMQDYQDSHILNCLSVPEEAISPGVTASWIEANLP
DDSKDTWKKRGSVDYVVLLDWFSSAKDLQLGTILRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLNFTYPSLEESLPSKPTAQMSRPIEVNES
IELTNNQNERVGPLNIPIPVEPIAASKSDVSPIIQPVPTVKIVPQIDRTKKPAVKLPEDH
RVKSESTDHEQQSPQDGRVVPDRSTKPIFPPPTAMLTDEEKARIHAETALLMEKNKQEKE
LRERQQEEQKEKLRKEEEEQKDRKKQEAEENEITEKQQNAKEQMEKRESEQAKKEDKETS
AKKGREITGVKRQSKSEHETTDAKKSVEDRGKRCPTPEMQKQSAGDIPHASVAGDSGSGK
TREPLTRARSEEMGRIVPGLPSGWGQAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAP
PSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRRPTVTPTVNRENKPTSY
PKAEITRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNC
YQEDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDS
QELLLFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEYAWQKHKQLNESIIVALFQGQ
FKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCR
ARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLAQYVIGPKNNLK
KYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISISSVKSSAAYILFYTSL
GPRVTDVAT
Download sequence
Identical sequences ENSSSCP00000004999 ENSSSCP00000004999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]