SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006500 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000006500
Domain Number - Region: 353-413
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00386
Family Papain-like 0.033
Further Details:      
 
Domain Number - Region: 216-323
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 0.0942
Family Cell-division protein ZipA, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006500   Gene: ENSSSCG00000006089   Transcript: ENSSSCT00000006680
Sequence length 473
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:43479298:43554464:-1 gene:ENSSSCG00000006089 transcript:ENSSSCT00000006680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTR
DDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGELRIFFVFVFFFFF
FKHIVIITTSIWYRTLIKYRLGESSLMEYAVNCHVITWERIISHFDIFAFGHFWGWAMKA
LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFL
EMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGVYLFMIIWQMG
NNNTHLNKWSLWLQSESESLWGRVHILYPLLRAAVEQYYAYLTDTQCKRVGTQCWVFGVI
GFLEAIVCIKFGQDLFSKTQILYVVLWLLCVAFTTFLCLYGMVWYAEHYGHREKTYSECE
DGTYSPDIAWPSGKGTKGSEDGPPKHPGNNESHSSRRRNRHSKSKVTNGVGKK
Download sequence
Identical sequences ENSSSCP00000006500 ENSSSCP00000006500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]