SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006542 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006542
Domain Number 1 Region: 335-531
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-70
Family Hemopexin-like domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 118-293
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.22e-55
Family Matrix metalloproteases, catalytic domain 0.0000000543
Further Details:      
 
Domain Number 3 Region: 36-105
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-20
Family MMP N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006542   Gene: ENSSSCG00000006132   Transcript: ENSSSCT00000006725
Sequence length 606
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:53437527:53598063:1 gene:ENSSSCG00000006132 transcript:ENSSSCT00000006725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIIYIYKQRRKIKLRHKSNMYFLDHAIFSLCFYVIKEEYQVLQVWLQKYGYLPPTDPRMS
VLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRYA
LTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRD
VDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLF
LVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTR
PLPTVPPHRSIPPVDPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFK
DQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQP
GYPHDLMTLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWK
GIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDKE
GHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKR
SMQEWV
Download sequence
Identical sequences ENSSSCP00000006542 ENSSSCP00000006542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]