SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007530 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007530
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000875
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 324-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000895
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 820-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000597
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 667-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000951
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 782-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000295
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 300-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 746-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 707-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000634
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000007530
Domain Number - Region: 855-912
Classification Level Classification E-value
Superfamily FnI-like domain 0.000188
Family VWC domain 0.041
Further Details:      
 
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007530   Gene: ENSSSCG00000007067   Transcript: ENSSSCT00000007738
Sequence length 1218
Comment pep:novel chromosome:Sscrofa10.2:17:22065796:22104506:-1 gene:ENSSSCG00000007067 transcript:ENSSSCT00000007738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCWASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCSRDECDTYFKVCLKEYQWRVTAGGPCSFGSGSTPVIGGNNFNLKASRGNERNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASYSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDEHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNGASCRDLVNGYRCVCPPGYA
GDHCETDIDECSSNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
FNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITVGSVIPDGAKWDDDCNACQCLDGRIACSKVWCGPR
PCSLHKGHSECPSGQSCIPILDTQCFVRPCTGVGECRSASFQPVKTKCASDPYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRKPSSHARSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQATYTLVDREEKPPNGTPAKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences F1SBK1
XP_005672756.1.46622 ENSSSCP00000007530 9823.ENSSSCP00000007530 ENSSSCP00000007530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]