SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009035 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009035
Domain Number 1 Region: 252-754
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.71e-49
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 
Domain Number 2 Region: 720-890
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000000275
Family WD40-repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009035   Gene: ENSSSCG00000008467   Transcript: ENSSSCT00000009269
Sequence length 982
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:104143457:104231472:-1 gene:ENSSSCG00000008467 transcript:ENSSSCT00000009269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPYFLYFIDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVPSKGQPGLREAISMSCITNGSGSNRKPSHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRPATAEK
SHNSWENSDDSRNKLFKAVSTSKLISKVIKNTDKHKDVIINQEGEYIKMFMRGRPITMFI
PSDVDNYDDIRTELPPEKLKLEWFRYGYRGKDCRANVYLLPTGEIVYFIASVVVLFNYEE
RTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVSLSTLQIIGL
GTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTNEVVLAVEFHP
TDANTIITCGKSHIFFWTWSGNSLTRKQGVFGKYEKPKFVQCLAFLGNGDVLTGDSGGII
LIWNKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTFCHMRNGMLLTGGGKDRKIILWDHD
LNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLA
THPFKDLLLTCAQDRQVCMWNSAEHKLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFV
LDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYVVSENGRKYSRHGKCTG
HSSYITHLDWSPENKYIMSNSGDYEILYWDIKENCKLIRNRSHCKDIDWTTYTCVLGFQV
FGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTN
VSFTHNDSHLISTGGKDMSIIQWKLVEKLPLPQNEIVADTTLTKAPISSIESIMQSDTPT
PPPSQPSNETAEEESRVSSSPTLLENSLEQTVEPSEGRSEEQSEGGSEELGEPVCEEPAS
EISEEHGEAALPEDQQDPSPLS
Download sequence
Identical sequences ENSSSCP00000009035 ENSSSCP00000009035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]