SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011091 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011091
Domain Number 1 Region: 635-710
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.53e-28
Family AN1-like Zinc finger 0.0000107
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.67e-26
Family Ubiquitin-related 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011091   Gene: ENSSSCG00000010402   Transcript: ENSSSCT00000011386
Sequence length 715
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:98686346:98753360:1 gene:ENSSSCG00000010402 transcript:ENSSSCT00000011386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNRKDPPFFNEDNVGPFYYKLPFYDTMELFIETLTGTCFELRVSPFEAIIYVKAKIQRL
EGIPICQQHLIWNNMELEDDYCLSDYNISEGCTLKLVLAMRGGPINTRRVPMEDPLREMA
EYMDSSRDEGWEKTSCNKQVTFLVYREGDQLNFFRVVDRGDGTLTPLSESLSGGSVYNLH
ADEDEEIEPSPSGQQIIENSITMNKMKLLKAKMENMNLSKKPKKAIKVKPRPPIAPRPSS
CSTAAARHRLLRVLPHIGQSCLPSPRNACLHDSTSNAISSLGTLPPADRPISSIASDFLK
EDDNWESNTLSHSNSGFKLPPEICHTESESDKELADSVAHLGLSLPRRTKLFSGNFPPNN
EDDTVLFSTSEECVTEESLLPEVGSFASCTEGNADEQSSGLEGTRKVNREFLLTNDDKGL
KATEQHLKHVARVLSGESVETTVLNNRELSPHKNRLLSPLRCSAPMALHNSLVKPQRRSK
CFESGNLQSSASQNVLRSLDVRNITDSSFSRTTRFRAVKVDSPGKRSDIISKVEARDITE
MANKASKEPVGCVNNIGFLASLARSASRDSLQSTRGAGRLRTSGTGLSTKLQHFQEESLR
KSSPQLEPSEFFLSTRGTGMNGNNTATGKRVGECTHHLPPVKAPIQTKKKTAKHCFLCGK
KTGLATSYECRCGNNFCASHRYAETHSCTYDYKSAGRRYLQEANPVVNAPKLPKI
Download sequence
Identical sequences ENSSSCP00000011091 ENSSSCP00000011091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]