SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012139 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012139
Domain Number 1 Region: 458-709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.56e-60
Family Eukaryotic proteases 0.0000404
Further Details:      
 
Domain Number 2 Region: 367-459
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-33
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 3 Region: 191-272
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-32
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 4 Region: 281-364
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 5 Region: 94-193
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-30
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 6 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.55e-17
Family Hairpin loop containing domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012139   Gene: ENSSSCG00000011386   Transcript: ENSSSCT00000012464
Sequence length 711
Comment pep:novel chromosome:Sscrofa10.2:13:35394134:35399064:-1 gene:ENSSSCG00000011386 transcript:ENSSSCT00000012464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTQCSGAPGQRSPLNDFQVLPGTELQHLLHAVGPGSWQEDVADAEECAGRC
GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLQHSGSFDLFQKKNYVRTCIMDNGVEYRG
TVAITMGGLPCQRWNLRFPNDHKYTPTLRNGLEENFCRNPDRDPGGPWCYTMDPAVRFQS
CGIKSCQEAVCFWVHGEDYRGSVDRTESGRECQRWDLQHPHPHPFEPLKFLDKNLDDNYC
RNPDGSERPWCYTTDPQVEREFCDLPRCGSGAQPRQEATTLNCFRGKGEGYRGMVNTTAA
GVPCQRWDAQHPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRVAFCYQIRR
CNDDVRPEDCYHGWGEQYRGSVSKTRKGVRCQSWSARTPHKPQFTPTSDPEAQLEENFCR
NPDGDSHGPWCYTTDPGIPFDYCALRRCDDDQPPSILEPPDPVLFEKCGKRVTRVDPRRS
KLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHVPLMGYEVWLGT
LFQNPQPGEPGLQRIPVAKMICGPSDSQLVLLKLERPATLNQRVALICLPPERYVVPPGT
KCEIAGWGETKGTGDDTVLNMASLNVISNQECNVKHRGRVRESEMCTEGLLAPVGACEGD
YGGPLACFTHDCWVLEGIIIPNRVCARPRWPAIFMRVSVFVDWINKVMRLG
Download sequence
Identical sequences ENSSSCP00000012139 ENSSSCP00000012139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]