SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013304 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013304
Domain Number 1 Region: 379-562
Classification Level Classification E-value
Superfamily NTF2-like 1.56e-62
Family NTF2-like 0.000000891
Further Details:      
 
Domain Number 2 Region: 113-202
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.59e-35
Family Non-canonical RBD domain 0.0000909
Further Details:      
 
Domain Number 3 Region: 212-366
Classification Level Classification E-value
Superfamily L domain-like 7.48e-32
Family mRNA export factor tap 0.00000341
Further Details:      
 
Domain Number 4 Region: 560-625
Classification Level Classification E-value
Superfamily UBA-like 3.32e-24
Family TAP-C domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013304   Gene: ENSSSCG00000028913   Transcript: ENSSSCT00000013680
Sequence length 629
Comment pep:known chromosome:Sscrofa10.2:X:97200764:97212408:-1 gene:ENSSSCG00000028913 transcript:ENSSSCT00000013680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WATDVSSRLSVRSPFTDYDDAGSSSQERSEGWSSSPHSLSKRSPRYEHGGYEPQPSGLQE
EDGNVMMMDVQEDPKGRDSPCTAAQQDNRRVKWHSEGHIHITVWTNGKPMEKETGENTQD
RTQSSWFKVTIPYGIKYDKTWLMDSIQSHCSVPFIPVDFHYVKSGARFFVQDASTASALM
DVNYKICDEEDQKIPIIVNPSDVVPYSVRNKLEPEEMEQLKLTLYKRYDVSQKALDLQRL
RFDPGLVGHDIDIILNRRNCMSATLQIIEKNFPELLSLNLSSNKLYRLDGLSDIIQMVPT
VKILNLSKNELKSAWELSKMKGLKLEELWLQGNPLCGTFPNQSTYISAIRECFPKLLRLD
GRVLPSPRIVNIDTPYVLKPCKESYKGSDALKSLILQFLQQYYLIYDSGDRYGLLGAYHQ
RACFSLTIPFNPKDPAPSSLYEYLEANRNMKKLKDPHLRVQLLKHTKHDIVHSLCVLPKT
QHDFSSFMVDMWLKTETMLCFSVTGVFKEVGGWSQGCVRAFTRTFIATPATSSSLFIVND
ELFVREASPKKTQSTFSISVPTPSTSSMPTLSEEQQQIVKAFSSQSGMNLQWSEKCLQDN
EWNYTRAGQVFSILKTEGKIPEEAFKVIP
Download sequence
Identical sequences ENSSSCP00000013304 ENSSSCP00000013304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]