SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014235 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014235
Domain Number 1 Region: 90-145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 34-90
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 147-195
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 234-287
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014235   Gene: ENSSSCG00000013393   Transcript: ENSSSCT00000014630
Sequence length 287
Comment pep:known chromosome:Sscrofa10.2:2:48089156:48609204:-1 gene:ENSSSCG00000013393 transcript:ENSSSCT00000014630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRERYVKQFPEDGSVCTLPTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKK
RHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRM
LKSLAELGDCNEELEQVEKCMLPECPIDCELTEWSQWSECNKSCGKGHMIRTRMIQMEPQ
FGGAPCPETVQRKKCRIRKCLRNPSIQKLRWREARESRRSEQLREESDGEQFPGCRMRPW
TAWSECTKLCGGGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVHPC
Download sequence
Identical sequences ENSSSCP00000014235 ENSSSCP00000014235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]