SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015907 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015907
Domain Number 1 Region: 271-463
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.71e-65
Family Hemopexin-like domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 99-258
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-54
Family Matrix metalloproteases, catalytic domain 0.00000603
Further Details:      
 
Domain Number 3 Region: 30-94
Classification Level Classification E-value
Superfamily PGBD-like 1.02e-19
Family MMP N-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015907   Gene: ENSSSCG00000014984   Transcript: ENSSSCT00000016346
Sequence length 513
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:37313392:37326432:-1 gene:ENSSSCG00000014984 transcript:ENSSSCT00000016346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLFWVLLTFSSAIPTDRKMENEENTQLAQAYLNQFYSLEIEGSHLVQSKNRSLIDGK
IREMQAFFGLTVTGKLDSNTLEIMKMPRCGVPDVGQYGYTLPGWKKYNLTYRIVNYTPDM
ARVDVDEAIQKGIEVWSNVTPLTFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLGHA
FPPGLGLGGDTHFDEDENWTKDGTGLSLFLVAAHEFGHSLGLSHSNDPTALMFPNYVSMD
PSKYPLSQDDVNGIQSIYENIPLGPAKSKEPTVPHACDPDLTFDAITTFRREVMFFKGRH
LWRIYYDITNIEFELISTFWPSLPADIQAAYENPKDKILVFKDDNFWMIRGYAVLPDYPK
SIRTLGFPRQVKKIDAAVCDHNTRKTYFFVGIWCWRYDEVTQTMDKGYPRRVVKYFPGIG
LRVDAAFQHKGFFYFFRRSKQFEYDPKTKNITRMMKTNTWFQCREPLNSSSDFTISEEKE
HSGGVELIYHKNLNLLIFSIVHHSILSVKFCLY
Download sequence
Identical sequences ENSSSCP00000027749 ENSSSCP00000015907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]