SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017132 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017132
Domain Number 1 Region: 1541-1715
Classification Level Classification E-value
Superfamily Fibronectin type III 5.65e-29
Family Fibronectin type III 0.0000502
Further Details:      
 
Domain Number 2 Region: 1907-2074
Classification Level Classification E-value
Superfamily Fibronectin type III 6.02e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 909-1080
Classification Level Classification E-value
Superfamily Fibronectin type III 6.27e-26
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 4 Region: 1266-1440
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-23
Family Fibronectin type III 0.00000909
Further Details:      
 
Domain Number 5 Region: 727-892
Classification Level Classification E-value
Superfamily Fibronectin type III 2.05e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 409-464
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-21
Family Fibronectin type II module 0.0000527
Further Details:      
 
Domain Number 7 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 1.48e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 8 Region: 1726-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-20
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 9 Region: 1449-1538
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-19
Family Fibronectin type III 0.00000548
Further Details:      
 
Domain Number 10 Region: 1174-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 6.48e-17
Family Fibronectin type III 0.00000301
Further Details:      
 
Domain Number 11 Region: 558-604
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000107
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 12 Region: 2341-2384
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 516-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000327
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 619-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000623
Family Fibronectin type III 0.00000454
Further Details:      
 
Domain Number 15 Region: 231-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000119
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 473-512
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000314
Family Fibronectin type I module 0.0000656
Further Details:      
 
Domain Number 18 Region: 2296-2339
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000802
Family Fibronectin type I module 0.0034
Further Details:      
 
Domain Number 19 Region: 50-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000209
Family Fibronectin type I module 0.00022
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2384-2425
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 191-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000314
Family Fibronectin type I module 0.00028
Further Details:      
 
Domain Number 23 Region: 307-345
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000012
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 1096-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000373
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 25 Region: 2210-2272
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000108
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017132   Gene: ENSSSCG00000016174   Transcript: ENSSSCT00000017610
Sequence length 2478
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:130357873:130430503:-1 gene:ENSSSCG00000016174 transcript:ENSSSCT00000017610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGPGPGLLLLAVLSLGTTVPSTGASKSKRQAQQIVQPQSPLVDSQRKPGCYDNGKHYQ
INQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDVRTAIYQPQPH
PQPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEP
CVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGAL
CHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYR
IGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGH
MLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHC
QPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPNRWKEATI
PGHLNSYTIKGLRPGVVYEGQLISVQHYGHREVTRFDFTTTSTSSAVTSNTVVGETTPFS
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETT
GVPRPDKVPPPKDLQFVEVTDVKVTIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPISRN
TFAEVTGLSPGVTYHFKVFAVNQGRESKPLTAQQTTKLDAPTNLQFINETDSTVMVTWTP
PRARIAGYRLTVGLTRGGQPKQYNVGPSASQYLLRNLQPGSEYAVTLVAVKGNQQSPRAT
GVFTTLQPVGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYTISVLRDGQERDTPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKNDKESVPI
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPINSSTIIGYRITVVAAGEGIPIFEDFADSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTIRVTWA
PPPSIELTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESI
PLRGRQKTGLDSPTGIDFSDITANSFTVYWIAPRATITGYKIRHHPEHMGGRPREDRVPP
SRNSITLTNLIPGVEYVVSIVAVNGREESPPLVGQQSTVSDVPRDLQVIATTPTSLLISW
DAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP
ASSKPVSIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSHVTGYRVTTTPKNGSGPSKTK
TVGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPKGLAFTDVDVDSI
KIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDD
MESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEI
NLAPDSSSVVVSGLMVATKYEVSIYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATET
TITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLND
NARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRAKITGYIIKYEKPGSPPREVV
PRPRPGVTEATITGLEPATEYTIQVIALKNNQKSEPLIGRKRTDELPQLVTLPHPNLHGP
EILDVPSTVQKTPFVTKPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTTATP
VRHRPGPYTPNVNEEIQVGHVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDQKRHKIREEVV
TVGNSVDQGLSQPTDDSCFDPYTVSHYAIGEEWERLSESGFKLSCQCLGFGSGHFRCDSS
KWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQW
QKEYLGAICSCTCFGGQRGWRCDNCRRPGAELGPEGSTGHSYNQYSQRYHQRTNTNVNCP
IECFMPLDVQADIEDSRE
Download sequence
Identical sequences ENSSSCP00000017132 ENSSSCP00000017132 9823.ENSSSCP00000017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]