SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017654 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017654
Domain Number 1 Region: 100-169
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000157
Family VWC domain 0.02
Further Details:      
 
Domain Number 2 Region: 226-302
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000023
Family VWC domain 0.022
Further Details:      
 
Domain Number 3 Region: 569-626
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000523
Family BSTI 0.047
Further Details:      
 
Domain Number 4 Region: 42-108
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000429
Family VWC domain 0.006
Further Details:      
 
Domain Number 5 Region: 179-232
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000105
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017654   Gene: ENSSSCG00000016665   Transcript: ENSSSCT00000018144
Sequence length 628
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:43218004:43462084:-1 gene:ENSSSCG00000016665 transcript:ENSSSCT00000018144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVTQDSCFTCILFCKQNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTYAGNTYNS
SFKWQSPTEPCILRQCQEGVVTESAVRCVVHCKNPSKHLGTCCPTCPGCVFEGVQYREGE
EFQPEGDKCTKCSCVEGRTQCLREVCPILSCPQHLSHIPPGQCCPRCLGQRKVFDLPFGS
CLFRSDVYDNGSSFLYDNCTACTCRDSTVVCKKKCSQPGGCDRGEGACCEECLLRVPSED
IKMCKFGNKIFRDGEMWSSINCTICACVKGQTECRKKQCVPISSCPQGKILNRKGCCPIC
TEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSW
TKSVDLVLGTSTVSLQQHLTVRWNGSRIALPCQAPQFHIDLDGYLLKVTTKAGLEISWDG
DSFVEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRP
QRKPVPELCQGTVRVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNC
YCESFLAYTRACQREGISVHWEPQQTCAATQCKHGAVYDTCGPGCVKTCDNWNEIGPCNK
PCVAGCHCPANLVLHKGRCIKPVLCPQR
Download sequence
Identical sequences ENSSSCP00000025024 ENSSSCP00000017654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]