SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017814 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017814
Domain Number 1 Region: 32-243
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.31e-58
Family Reprolysin-like 0.00041
Further Details:      
 
Domain Number 2 Region: 330-385
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000262
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 3 Region: 1281-1339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 749-801
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000122
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1169-1233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000706
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 1228-1281
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 1123-1174
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 8 Region: 682-745
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017814   Gene: ENSSSCG00000016816   Transcript: ENSSSCT00000018309
Sequence length 1402
Comment pep:known_by_projection chromosome:Sscrofa10.2:16:20237302:20549746:-1 gene:ENSSSCG00000016816 transcript:ENSSSCT00000018309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSLGTSQKQELQREKWERSSSPSRSLSRRSISKERWVETLVVADTKMIEYHGSENVESYI
LTIMNMVTGLFHNPSIGNAIHIVVVRLILLEEEEQGLKIVHHADKTLSSFCKWQKSINPK
SDLNPAHHDVAVLLTRKDICAGVNRPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIA
HELGHSFGIQHDGKENDCEPVGRHPYIMSRQLQYNPAPLTWSKCSKEYITRFLDRGWGFC
LDDIPKKKGLKSKVIAPGVIYDVHHQCQLQYGPNATFCQEVENVCQTLWCSVKGFCRSKL
DAAADGTRCGEKKWCMAGKCITVGKKPESIPGGWGRWSPWSHCTRTCGAGAQSAERLCNN
PEPKFGGKYCTGERKRYRLCNVHPCRPDTPTFRQMQCSEFDTVPYKNEFYRWFPVFNPEH
KRTHRSQPINENYMFELLFALLVGTPGDDNVTRGNSRNRCVSKKCKKLSCDHYLLNKKTE
GKCGGLAFVCLSDISFCIRKKKLFPQSQGLKSVDLCNPPSGRKKDYRQHEVLTAGVLLFM
TSEVPTKYILNEEFVLDWRCNNYQVFQTIFSRYQFNKRDEEKLSSQSPKKGVVWPENLLF
RTYSQNMQGLHTANISGVDNNVDKIFYFFLFGIPSWVGLQCSVNCSTCIRRQTAHCVKKG
HGMVKATFCDPETQPNGRQKKCYEKDCPPRWWAGEWEACSATCGPHGEKKRTVLCIQTMG
SDEQALPATDCQHLLKPKTLISCNRDILCPSDWTVGNWSECSVSCGGGVRIRSVTCAKNH
HEPCDVTRKPNSRALCGLQQCPSSRRILKPNKGTISPGKKLPTSDPFKPLPLTTPGPGML
TTAPTVPGSMSTSALATSSPGPTTASKGDLDGNQWQNRSTQTEPDPHDIISMGSTSQPIL
TSWSLSLQPNEANVSNPDTGPPSEGDLSATTMSGSDLSPSSNPVTWGVTPFYKPLTKEPE
IEIHSGSGEDGEQPEDKNQNGSVTWTKIRAPGNAAPVERSTDMPLGPLPTPYLKGASLWP
PFSTVSEGLLPSQRPATLKNGAPSTEGMVAEKPANTPPPLGEDHQPAYSEKSINHHPLEL
PSSVNLTQSSGPGLTEEDATSLIAEGFLLNASDYKQLSMGRSPAHWIVGNWSECSTTCGL
GAYWRSVECSTHVDSDCAAIQRPDPAKKCHLRPCAGWKVGNWSKCSRNCSGGFQIREIQC
VDNRDHRSLRPFHCQFLAGIPPPVSMSCNPDPCEEWQVEPWSQCSRSCGGGVQERRVTCP
GGHCDWMKRPKSTAPCNGHLCCHWVTGHWGLCTASCGGGFQKRMVHCVASENKTEGQDGC
LCDHEPRPLEMQKCNQQACRKNADLPCTKDNLSASFCQTLKTMKKCSMPTVRVQCCVSCS
QTHVAHTQRPRKRQSLQKPNAP
Download sequence
Identical sequences ENSSSCP00000026540 ENSSSCP00000017814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]