SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018339 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018339
Domain Number 1 Region: 129-376
Classification Level Classification E-value
Superfamily vWA-like 1.82e-85
Family Integrin A (or I) domain 0.000000000531
Further Details:      
 
Domain Number 2 Region: 372-462
Classification Level Classification E-value
Superfamily Integrin domains 4.39e-34
Family Integrin domains 0.00000441
Further Details:      
 
Domain Number 3 Region: 628-712
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.97e-24
Family Integrin beta tail domain 0.00000578
Further Details:      
 
Domain Number 4 Region: 25-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000241
Family Plexin repeat 0.0000648
Further Details:      
 
Domain Number 5 Region: 586-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Integrin beta EGF-like domains 0.00035
Further Details:      
 
Domain Number 6 Region: 544-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000018339
Domain Number - Region: 512-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018339   Gene: ENSSSCG00000017306   Transcript: ENSSSCT00000018842
Sequence length 784
Comment pep:known chromosome:Sscrofa10.2:12:16717754:16775469:-1 gene:ENSSSCG00000017306 transcript:ENSSSCT00000018842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARPLWAAVLVVGALAGVGVGGPNICATRGVSSCQQCLAVSPMCAWCSDEDLPLGTPRC
NLEENLLNDHCNPKYIEFPISEARILEARPLSDKGSGDSSQITQVSPQRILLRLRPDDSK
SFSVQVRQVEDYPVDIYYLMDLSFSMKDDLESIQNLGTKLASQMRKLTSNLRIGFGAFVD
KPVSPYMYISPPQALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQNVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLITEKLSQKNINLIFAVTEGVVSLYQNYSELIPGTTVGVLSSNSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPREKEKSFTIKPVGFKDSLTVQVTFNCDCDCQAQAEPDSPRCNNGNGTFECG
VCHCGPGWLGFQCECSEKDYRPSQQDECSPQQGQPICSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVHYKGEMCSGHGQCSCGDCLCDSDWTGFYCNCTTRTDTCLSSNGLLCSGR
GNCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKGCVECKKFNRGSLYEANTCNRYCRDE
IESVKELQDSGKNAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
Download sequence
Identical sequences Q95JH1
NP_999167.1.46622 ENSSSCP00000018339 ENSSSCP00000029145 ENSSSCP00000018339 9823.ENSSSCP00000018339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]