SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019444 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019444
Domain Number 1 Region: 1123-1259,1317-1383
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.49e-39
Family Hemopexin-like domain 0.0008
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000745
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000144
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019444   Gene: ENSSSCG00000029449   Transcript: ENSSSCT00000031330
Sequence length 1383
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:139907717:139933040:1 gene:ENSSSCG00000029449 transcript:ENSSSCT00000031330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKILPIFLFLPLSVILIQQVSSQDLSSCAGRCGEGYSRDAICNCDYNCQHYMECCPDF
KKVCTMELSCRGRCFESFARGRECDCDSDCKKYGKCCSDYDNFCEEVHNPTSPPSSKTAP
PLPGASQTIKSTIKRSPKSPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKI
KSSKNSAANRELKKKPKVKDNKKKKRTPKKKPTPEPPVIDDAGSGLNNGDIKLIPTPDIP
TTQRSNKVTTTPKITTVKPIIPKPSLPPNSETTKVTPSTANKETTVETKETSTTNKQTAS
AKETTTKDSAPTSEVPATSTPKAETTTKSPALTSPKDLVPTTPKKPAPAIPSEPAPTTKK
PVSTTPKEPSPTTKGPIPTTTREPAPTTTKKQSPTSPKEPAPTTVKEPASTTPKEPEPTT
PKEAAPTTPKDPASNTPKEPALTTSPKEPAPTTPKESAPTTTTKEPASTTPKEQAPTTPK
EIAPTFPKEPAPTTPKEPAATTPKEPVPTTTKEPAPTTTSKEAAPTTPKELAPTTTKEPA
SHHPQEACPPHHISPMPYTPHKVAKSAPSVPKSLGDPRPAPLFEDPAPSLPVSSVSRPSS
LNRHLVQTVESENTLCNLNPKFLTPLGFSESLFLENGGATVQPPSPGVAGDPEGWREPGG
WGPEECLSTSPQTFPPSPRGSIFPLGPKGTTQAPALAFDPASQSPEEPRSSDSSGDTGKR
PVYLLQPPACDWGIPGAGPQCHNCARVYTHVYFPCAASPPPPSEAELQCPPTLSGQGPTT
PKKPVPPTPEKPDLTTNREAAPTITNEAAPTTKEPAPATPKKPTPSSPEIPAPITSEAST
STTTMEPPTTPKNSAKSTPESAVEPTPKAVENSPKEPTVPTTKAPTVTKPEMTTRAKDKD
TEKDMYTIPEMTTAAPKTVTETAIKTEEKASESKITTTQVTSTPTEDTTTSSKTTLKPTT
LVPKVMTTTKKTTEKAMSKPEQTTSIPKDRATNSQVTTPKPPKPTKAPKKPTSTKKPKAP
KGRKPKTTPTPPKSTTSVLPKTSPTAVAEATLQTTTIPQQTLNSEIIDINPKNEDADTAE
GEKPQLIPRPPVLTPIVIPGTDFTVRGHNQGIGINPIFPDETNLCNGRPVDGLTTLHNGT
LVAFRGHYFWMLNPFTPPSPPRRITEVWGIPSPIDTVFTRCNCERKTFFFKDSQYWRFTN
DIKDAGYPKLISKGFGGLNGKIVAALSIAKYKNRPESVYFFKRGGSIQQYTYKQEPITKC
TGRRPAVHYSVYGETTQVRRRRFERAIGPSKTHTIRIQYSPIRLTYQDKGFLHNEVKVST
LWRGLPNVVTSAISLPNIRRPDGYDYYAFSRDQYYNIDVPQRTARAITTRSGQTLSNVWY
NCP
Download sequence
Identical sequences ENSSSCP00000019444 ENSSSCP00000019444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]