SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000019620 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000019620
Domain Number 1 Region: 136-227
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-35
Family TAFH domain-like 0.0000035
Further Details:      
 
Domain Number 2 Region: 537-584
Classification Level Classification E-value
Superfamily Histone-fold 7.53e-17
Family TBP-associated factors, TAFs 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000019620   Gene: ENSSSCG00000024694   Transcript: ENSSSCT00000031262
Sequence length 753
Comment pep:known_by_projection chromosome:Sscrofa10.2:17:69010095:69054750:-1 gene:ENSSSCG00000024694 transcript:ENSSSCT00000031262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAQAQAQPQSSMGPRPATPTSAPPVQISAVQVTPTT
IIKQVSQAQTTVQPTGALQRSPGVQVRLVPTAPCCSAELNTSSTLKSFPLGCVTLVVSGS
PQSGGDHCAGGSSSLEETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQSLLDGK
IEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPASQATTA
LTAVVLSGSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKQGQPTPLVTLTQTPMVAL
RQPHSRIVLTTPQQIQLNQLQPGEPRSWASSRTEAEGAAREAARVVCGSGGGSGVGSAGA
CTGHPVSAVSGLSSPAAASPGLQEVRRGQMLPRPRCALLLGLELVTRCGEKHHRSGLGAV
ALPSAHPALERAARLRAQRLRVPAQWHTLVSCFAVPVVKPAVLPGTKALSAVSAQAAAAQ
KNKLKEPGGGSFRRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLP
APLQRRILEIGKKHGITELHPDVVGYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYE
QASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEKTKMQ
QQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGAEGAGPGSAVPGSSGVGTPRQFTR
QRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSSSCP00000019620 ENSSSCP00000027122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]