SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023679 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023679
Domain Number 1 Region: 15-62
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000334
Family LEM domain 0.0000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023679   Gene: ENSSSCG00000027020   Transcript: ENSSSCT00000022726
Sequence length 427
Comment pep:known scaffold:Sscrofa10.2:GL894696.2:6029:24904:1 gene:ENSSSCG00000027020 transcript:ENSSSCT00000022726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KATKKTDKPRLEDKDDLDVTELTNEELLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQG
TESRSSTPLPTISSSVENTRQNGSNDSDRYSDNEEVPTTPSGISFPETSTRPPLGRTERQ
AAKKSSHGRCLEKSSSTSSQHELAALLVSAAASPSLIKETTNTCYKDIVENIYCGEKSGI
QPLCTKRSHDSDQSTLSSERKALEESERSQVISPPLAQAIRDYVNSLLVQGGIDISIHQN
LNLDQCQSAIGKLLGSGVDTVKITSFLRNFLVDSTSTRPELTPFLCVVKSSPSNDDKTKT
RKVVGEKTEERRVERDILKEMFPFEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFS
SKYIPKYVPLADVKSEKTKKGRSIPMWIKILLFVVVAIFLFLVYQAMETNQGNPFYQFIS
NNSKNAN
Download sequence
Identical sequences ENSSSCP00000023679 ENSSSCP00000023679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]