SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025365 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025365
Domain Number 1 Region: 360-539
Classification Level Classification E-value
Superfamily NTF2-like 1.75e-61
Family NTF2-like 0.00000131
Further Details:      
 
Domain Number 2 Region: 91-180
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.59e-35
Family Non-canonical RBD domain 0.000077
Further Details:      
 
Domain Number 3 Region: 190-344
Classification Level Classification E-value
Superfamily L domain-like 6.46e-31
Family mRNA export factor tap 0.00000356
Further Details:      
 
Domain Number 4 Region: 538-604
Classification Level Classification E-value
Superfamily UBA-like 6.38e-24
Family TAP-C domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025365   Gene: ENSSSCG00000026976   Transcript: ENSSSCT00000024111
Sequence length 608
Comment pep:novel chromosome:Sscrofa10.2:X:97547675:97557611:1 gene:ENSSSCG00000026976 transcript:ENSSSCT00000024111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSSSQERSEGWSSSPHSLSKRSPRYEHGGYEPQPSGLQEEDGNVMMMDVQEDPKGRDSPY
TARGDKRRVRWHSEGHIHITVWRDRKLLEREKGKNTQDRTLSSWFKVTIPHGRKYDKTWL
MDSIQSRCSVPFTPVDFHCVKNQARFFVQDASTASALKDVSYEICDKDNRKIPIIVNPSD
VVPYSVHDKLKPGEMEQLKLTLHKRYNISQQALDLQRLRYDPDLTGHDIDIILNRRNCMS
ATLQVIKKNFPELLSLNLSSNKLYRLDGLSDIIQMVPMVKILNLSKNELKSAWELSKMKG
LKLEELWLQGNPLCSTFPDQSTYVSAIRECFPKLLRLDGQELLSPSIVDNDAPYVLKPCK
ESYKGSNELKSLILQFLRQYYLIHDYGDRRRLLGAYHNEACFSLTIPFHPEDPDPSSLYE
YLEENRNMKKLKDPHLRVQLLKHTKGDIVTSLCVLPKTQHDLSSFVVDMWFQTETMLCFS
INGVFKEVEGQSRGCVRAFTRTFITTPATSSSLCIVNDELFVREASPSETQSAAFFIPVP
TASASSVCTLSQELQEMVQAFSTQSGMKLEWSQKCLQDNEWNYTRAGQVFSILKTEGKIP
EEAFKEIP
Download sequence
Identical sequences ENSSSCP00000025365 ENSSSCP00000025365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]