SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030031 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030031
Domain Number 1 Region: 404-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-28
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 170-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 53-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 221-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000368
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030031   Gene: ENSSSCG00000012121   Transcript: ENSSSCT00000035913
Sequence length 558
Comment pep:known chromosome:Sscrofa10.2:X:10924788:11237583:1 gene:ENSSSCG00000012121 transcript:ENSSSCT00000035913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISEPGSRPSPDIKSASTSILDLWPPELPRNHGLLALSLQPGVCRYGTTLACCYGWRRS
SKGVCEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGVKPRPCQHRCVNTHGSY
KCFCLSGHMLMPDATCSNSRTCAVTSCQYGCEDTEAGPRCLCPSPGLRLAPNGRACIDID
ECTSDKAVCPYNRRCVNTFGSYYCKCHVGFELKYIRGRYDCVDVNECAANTHTCSLHATC
LNILGSFKCKCKQGYKGSGLQCSVIPENAVKEFLIVPGSIRDRIKKLLAHKNGTKKKVFI
KNVITEPMGTPTPKVGSQPFGSEESVSRDENHRGERKRSEETKKERPEEERRDEKALENH
VEQEQSLRGDVFSPKVNEAGELDLIVVQRKATTSRLEHRDLNISVDCSFDHGVCDWKQDV
EDDFDWNPADRDNAVGYYMAVPALAGQKKDIGRLKLLLPDLQPQSNLCLLFHYRLAGNKV
GKLRVFVKNSNSALAWEKTRSADERWKMGKIQLYRGVGTPKSIIFEAERGKGRTGEIALD
GVLLLSGFCPDGPLSVDN
Download sequence
Identical sequences ENSSSCP00000030031 ENSSSCP00000030031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]