SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386034389|ref|YP_005954302.1| from Klebsiella pneumoniae KCTC 2242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386034389|ref|YP_005954302.1|
Domain Number 1 Region: 20-276,372-403
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2e-70
Family Type II chitinase 0.0000773
Further Details:      
 
Domain Number 2 Region: 289-356
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000527
Family Chitinase insertion domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386034389|ref|YP_005954302.1|
Sequence length 417
Comment putative chitinase II [Klebsiella pneumoniae KCTC 2242]
Sequence
MKRLPLLAALPLLCASALSAQPLMSVGYFNGGGDVTAGPGGDIDKLDVRQITHLNYSFGL
IYNDEKDETNAALKDPAHLHEIWLSPKVQADLQKLPALRKQNPDLKVLLSVGGWGARGFS
GAAATAESRAVFIRSAQKIIQQYGLDGIDLDWEFPVNGAWGLVASQPADRDNFTALLKSL
REAVGEQKLVTIAVGANAESPKSWVDVKAVAPVLNYINLMTYDMAYGTQYFNSNLYDSSH
WPTVAAADKYSADFVVNNYLAAGLKPSQMNLGIGFYGRVPKRAVEPGIDWTKADAQNNPV
TQPYFGPQQIALFASLGYDLSKDTYVKYNDIVGKLLNDPQKRFTEHWDDEAKVPWLSVQS
AEGKPLFALSYENPRSVAIKADYIKAKGLAGAMFWEYGADDQNQLARQLAESLGIKH
Download sequence
Identical sequences A0A086I5U9 A0A0H3GRG6 A0A1D3U5S9 A0A1Y0Q026 A0A2G8AND3 A6T7R3 V0B2A3 W1HXT1
WP_002901255.1.100145 WP_002901255.1.100239 WP_002901255.1.100465 WP_002901255.1.100514 WP_002901255.1.100566 WP_002901255.1.100599 WP_002901255.1.10061 WP_002901255.1.100635 WP_002901255.1.100698 WP_002901255.1.100702 WP_002901255.1.100713 WP_002901255.1.100896 WP_002901255.1.10092 WP_002901255.1.100964 WP_002901255.1.10101 WP_002901255.1.10102 WP_002901255.1.101234 WP_002901255.1.101332 WP_002901255.1.10134 WP_002901255.1.101391 WP_002901255.1.101480 WP_002901255.1.101526 WP_002901255.1.101549 WP_002901255.1.101648 WP_002901255.1.101702 WP_002901255.1.101867 WP_002901255.1.101892 WP_002901255.1.10194 WP_002901255.1.101972 WP_002901255.1.10203 WP_002901255.1.102072 WP_002901255.1.102075 WP_002901255.1.102090 WP_002901255.1.10213 WP_002901255.1.102146 WP_002901255.1.10218 WP_002901255.1.10227 WP_002901255.1.10278 WP_002901255.1.10291 WP_002901255.1.10296 WP_002901255.1.10395 WP_002901255.1.10456 WP_002901255.1.10473 WP_002901255.1.10604 WP_002901255.1.1061 WP_002901255.1.10778 WP_002901255.1.10889 WP_002901255.1.10908 WP_002901255.1.11020 WP_002901255.1.11036 WP_002901255.1.11092 WP_002901255.1.11122 WP_002901255.1.11147 WP_002901255.1.11191 WP_002901255.1.11237 WP_002901255.1.11267 WP_002901255.1.11269 WP_002901255.1.11338 WP_002901255.1.11349 WP_002901255.1.11502 WP_002901255.1.11506 WP_002901255.1.11535 WP_002901255.1.11551 WP_002901255.1.11555 WP_002901255.1.11601 WP_002901255.1.11647 WP_002901255.1.11675 WP_002901255.1.11683 WP_002901255.1.11685 WP_002901255.1.11694 WP_002901255.1.11742 WP_002901255.1.11783 WP_002901255.1.11791 WP_002901255.1.11808 WP_002901255.1.11864 WP_002901255.1.11891 WP_002901255.1.1193 WP_002901255.1.11962 WP_002901255.1.11994 WP_002901255.1.12003 WP_002901255.1.12032 WP_002901255.1.12074 WP_002901255.1.12082 WP_002901255.1.12086 WP_002901255.1.12089 WP_002901255.1.12108 WP_002901255.1.1226 WP_002901255.1.12418 WP_002901255.1.12445 WP_002901255.1.12481 WP_002901255.1.12564 WP_002901255.1.12602 WP_002901255.1.12689 WP_002901255.1.12712 WP_002901255.1.12722 WP_002901255.1.12747 WP_002901255.1.12760 WP_002901255.1.12900 WP_002901255.1.12939 WP_002901255.1.13030 WP_002901255.1.13044 WP_002901255.1.13171 WP_002901255.1.13202 WP_002901255.1.1322 WP_002901255.1.13386 WP_002901255.1.13450 WP_002901255.1.13483 WP_002901255.1.13524 WP_002901255.1.13541 WP_002901255.1.13594 WP_002901255.1.13690 WP_002901255.1.13717 WP_002901255.1.13773 WP_002901255.1.13783 WP_002901255.1.13922 WP_002901255.1.14090 WP_002901255.1.14109 WP_002901255.1.14118 WP_002901255.1.14171 WP_002901255.1.14232 WP_002901255.1.14241 WP_002901255.1.14248 WP_002901255.1.14252 WP_002901255.1.14290 WP_002901255.1.14407 WP_002901255.1.1441 WP_002901255.1.14438 WP_002901255.1.14585 WP_002901255.1.14594 WP_002901255.1.14603 WP_002901255.1.1464 WP_002901255.1.14653 WP_002901255.1.14715 WP_002901255.1.14732 WP_002901255.1.14735 WP_002901255.1.1478 WP_002901255.1.14796 WP_002901255.1.14813 WP_002901255.1.14830 WP_002901255.1.14851 WP_002901255.1.14941 WP_002901255.1.14986 WP_002901255.1.15060 WP_002901255.1.15063 WP_002901255.1.15082 WP_002901255.1.1513 WP_002901255.1.15194 WP_002901255.1.15243 WP_002901255.1.1532 WP_002901255.1.15339 WP_002901255.1.15491 WP_002901255.1.15574 WP_002901255.1.15610 WP_002901255.1.15629 WP_002901255.1.15715 WP_002901255.1.1572 WP_002901255.1.15806 WP_002901255.1.15832 WP_002901255.1.15839 WP_002901255.1.15852 WP_002901255.1.15878 WP_002901255.1.15942 WP_002901255.1.1596 WP_002901255.1.15994 WP_002901255.1.160 WP_002901255.1.16054 WP_002901255.1.16128 WP_002901255.1.16196 WP_002901255.1.16289 WP_002901255.1.16299 WP_002901255.1.16314 WP_002901255.1.16380 WP_002901255.1.16536 WP_002901255.1.16542 WP_002901255.1.16659 WP_002901255.1.16738 WP_002901255.1.16758 WP_002901255.1.16917 WP_002901255.1.1702 WP_002901255.1.17211 WP_002901255.1.17236 WP_002901255.1.17326 WP_002901255.1.17556 WP_002901255.1.17587 WP_002901255.1.17736 WP_002901255.1.17768 WP_002901255.1.17846 WP_002901255.1.17921 WP_002901255.1.18148 WP_002901255.1.18150 WP_002901255.1.18171 WP_002901255.1.18176 WP_002901255.1.18217 WP_002901255.1.18284 WP_002901255.1.18296 WP_002901255.1.18351 WP_002901255.1.18378 WP_002901255.1.18409 WP_002901255.1.18431 WP_002901255.1.18515 WP_002901255.1.18552 WP_002901255.1.18664 WP_002901255.1.18682 WP_002901255.1.1869 WP_002901255.1.18695 WP_002901255.1.18716 WP_002901255.1.18736 WP_002901255.1.18788 WP_002901255.1.18832 WP_002901255.1.18932 WP_002901255.1.18964 WP_002901255.1.18981 WP_002901255.1.19058 WP_002901255.1.19209 WP_002901255.1.19278 WP_002901255.1.19317 WP_002901255.1.1937 WP_002901255.1.19421 WP_002901255.1.19533 WP_002901255.1.19664 WP_002901255.1.19786 WP_002901255.1.19885 WP_002901255.1.19888 WP_002901255.1.19911 WP_002901255.1.19984 WP_002901255.1.20019 WP_002901255.1.20122 WP_002901255.1.20179 WP_002901255.1.20217 WP_002901255.1.2023 WP_002901255.1.20278 WP_002901255.1.20426 WP_002901255.1.2044 WP_002901255.1.2045 WP_002901255.1.20472 WP_002901255.1.205 WP_002901255.1.20528 WP_002901255.1.20639 WP_002901255.1.2068 WP_002901255.1.20750 WP_002901255.1.20823 WP_002901255.1.20902 WP_002901255.1.21023 WP_002901255.1.21088 WP_002901255.1.21228 WP_002901255.1.21323 WP_002901255.1.21566 WP_002901255.1.21587 WP_002901255.1.21799 WP_002901255.1.21813 WP_002901255.1.21851 WP_002901255.1.21854 WP_002901255.1.21869 WP_002901255.1.21892 WP_002901255.1.21913 WP_002901255.1.2193 WP_002901255.1.21936 WP_002901255.1.21953 WP_002901255.1.21968 WP_002901255.1.22001 WP_002901255.1.22044 WP_002901255.1.22072 WP_002901255.1.22129 WP_002901255.1.22191 WP_002901255.1.22215 WP_002901255.1.22398 WP_002901255.1.22405 WP_002901255.1.22447 WP_002901255.1.2249 WP_002901255.1.2258 WP_002901255.1.22584 WP_002901255.1.22607 WP_002901255.1.22630 WP_002901255.1.22648 WP_002901255.1.2265 WP_002901255.1.22686 WP_002901255.1.22698 WP_002901255.1.22712 WP_002901255.1.2272 WP_002901255.1.22910 WP_002901255.1.22929 WP_002901255.1.22932 WP_002901255.1.22956 WP_002901255.1.23071 WP_002901255.1.23112 WP_002901255.1.23144 WP_002901255.1.23454 WP_002901255.1.2346 WP_002901255.1.2347 WP_002901255.1.23543 WP_002901255.1.23560 WP_002901255.1.23562 WP_002901255.1.23564 WP_002901255.1.23607 WP_002901255.1.23614 WP_002901255.1.23672 WP_002901255.1.23673 WP_002901255.1.23758 WP_002901255.1.23868 WP_002901255.1.23877 WP_002901255.1.23921 WP_002901255.1.23981 WP_002901255.1.23982 WP_002901255.1.24027 WP_002901255.1.24036 WP_002901255.1.24055 WP_002901255.1.24103 WP_002901255.1.24209 WP_002901255.1.24211 WP_002901255.1.2432 WP_002901255.1.24342 WP_002901255.1.24353 WP_002901255.1.244 WP_002901255.1.24566 WP_002901255.1.24587 WP_002901255.1.24590 WP_002901255.1.24635 WP_002901255.1.24707 WP_002901255.1.24801 WP_002901255.1.24816 WP_002901255.1.24822 WP_002901255.1.24911 WP_002901255.1.24919 WP_002901255.1.24951 WP_002901255.1.2513 WP_002901255.1.25163 WP_002901255.1.25239 WP_002901255.1.25254 WP_002901255.1.25275 WP_002901255.1.25306 WP_002901255.1.2536 WP_002901255.1.25379 WP_002901255.1.25407 WP_002901255.1.25429 WP_002901255.1.25492 WP_002901255.1.25559 WP_002901255.1.25563 WP_002901255.1.25575 WP_002901255.1.25904 WP_002901255.1.25938 WP_002901255.1.25942 WP_002901255.1.25987 WP_002901255.1.26045 WP_002901255.1.26200 WP_002901255.1.26219 WP_002901255.1.26285 WP_002901255.1.26299 WP_002901255.1.26308 WP_002901255.1.26336 WP_002901255.1.26342 WP_002901255.1.26396 WP_002901255.1.26427 WP_002901255.1.26448 WP_002901255.1.26515 WP_002901255.1.26762 WP_002901255.1.2683 WP_002901255.1.26830 WP_002901255.1.26843 WP_002901255.1.2686 WP_002901255.1.26890 WP_002901255.1.26974 WP_002901255.1.27054 WP_002901255.1.27144 WP_002901255.1.27224 WP_002901255.1.27264 WP_002901255.1.27268 WP_002901255.1.27319 WP_002901255.1.27356 WP_002901255.1.27443 WP_002901255.1.27477 WP_002901255.1.27488 WP_002901255.1.27543 WP_002901255.1.27550 WP_002901255.1.27703 WP_002901255.1.27722 WP_002901255.1.27766 WP_002901255.1.27809 WP_002901255.1.27828 WP_002901255.1.27925 WP_002901255.1.2796 WP_002901255.1.28049 WP_002901255.1.28083 WP_002901255.1.28112 WP_002901255.1.28115 WP_002901255.1.28135 WP_002901255.1.2814 WP_002901255.1.28203 WP_002901255.1.28291 WP_002901255.1.28375 WP_002901255.1.28446 WP_002901255.1.28463 WP_002901255.1.28660 WP_002901255.1.28688 WP_002901255.1.2870 WP_002901255.1.28717 WP_002901255.1.28764 WP_002901255.1.28910 WP_002901255.1.28972 WP_002901255.1.28974 WP_002901255.1.29072 WP_002901255.1.29120 WP_002901255.1.29240 WP_002901255.1.29334 WP_002901255.1.29346 WP_002901255.1.29424 WP_002901255.1.29448 WP_002901255.1.29506 WP_002901255.1.29529 WP_002901255.1.29636 WP_002901255.1.29726 WP_002901255.1.29772 WP_002901255.1.29829 WP_002901255.1.29858 WP_002901255.1.29871 WP_002901255.1.2990 WP_002901255.1.29915 WP_002901255.1.2999 WP_002901255.1.30078 WP_002901255.1.30132 WP_002901255.1.30207 WP_002901255.1.30218 WP_002901255.1.30296 WP_002901255.1.30390 WP_002901255.1.30416 WP_002901255.1.30426 WP_002901255.1.30455 WP_002901255.1.30471 WP_002901255.1.30478 WP_002901255.1.30576 WP_002901255.1.30634 WP_002901255.1.30704 WP_002901255.1.30897 WP_002901255.1.30929 WP_002901255.1.3099 WP_002901255.1.3111 WP_002901255.1.31257 WP_002901255.1.313 WP_002901255.1.31374 WP_002901255.1.3138 WP_002901255.1.31400 WP_002901255.1.31536 WP_002901255.1.3159 WP_002901255.1.31591 WP_002901255.1.31630 WP_002901255.1.3164 WP_002901255.1.31648 WP_002901255.1.31890 WP_002901255.1.31920 WP_002901255.1.31938 WP_002901255.1.31948 WP_002901255.1.32023 WP_002901255.1.32057 WP_002901255.1.32086 WP_002901255.1.32211 WP_002901255.1.32212 WP_002901255.1.32300 WP_002901255.1.32336 WP_002901255.1.32354 WP_002901255.1.32369 WP_002901255.1.32371 WP_002901255.1.32749 WP_002901255.1.32797 WP_002901255.1.32809 WP_002901255.1.3282 WP_002901255.1.32849 WP_002901255.1.32857 WP_002901255.1.33057 WP_002901255.1.33136 WP_002901255.1.33399 WP_002901255.1.33406 WP_002901255.1.33414 WP_002901255.1.33435 WP_002901255.1.33446 WP_002901255.1.33481 WP_002901255.1.33498 WP_002901255.1.33539 WP_002901255.1.33544 WP_002901255.1.3361 WP_002901255.1.33642 WP_002901255.1.33704 WP_002901255.1.33750 WP_002901255.1.33755 WP_002901255.1.3378 WP_002901255.1.33794 WP_002901255.1.33806 WP_002901255.1.33831 WP_002901255.1.33836 WP_002901255.1.33889 WP_002901255.1.33942 WP_002901255.1.33985 WP_002901255.1.34110 WP_002901255.1.34113 WP_002901255.1.34173 WP_002901255.1.34200 WP_002901255.1.34213 WP_002901255.1.34258 WP_002901255.1.34281 WP_002901255.1.34311 WP_002901255.1.34316 WP_002901255.1.34367 WP_002901255.1.34390 WP_002901255.1.34439 WP_002901255.1.3450 WP_002901255.1.34507 WP_002901255.1.34636 WP_002901255.1.34681 WP_002901255.1.34696 WP_002901255.1.34706 WP_002901255.1.34748 WP_002901255.1.34771 WP_002901255.1.34850 WP_002901255.1.34853 WP_002901255.1.34885 WP_002901255.1.34910 WP_002901255.1.34955 WP_002901255.1.35028 WP_002901255.1.35197 WP_002901255.1.35214 WP_002901255.1.35268 WP_002901255.1.35284 WP_002901255.1.3529 WP_002901255.1.35453 WP_002901255.1.35568 WP_002901255.1.35574 WP_002901255.1.35645 WP_002901255.1.35699 WP_002901255.1.35786 WP_002901255.1.35793 WP_002901255.1.35814 WP_002901255.1.35850 WP_002901255.1.35863 WP_002901255.1.35914 WP_002901255.1.36018 WP_002901255.1.36025 WP_002901255.1.36029 WP_002901255.1.3605 WP_002901255.1.36080 WP_002901255.1.36130 WP_002901255.1.36151 WP_002901255.1.36204 WP_002901255.1.36237 WP_002901255.1.36261 WP_002901255.1.36306 WP_002901255.1.36383 WP_002901255.1.36388 WP_002901255.1.3640 WP_002901255.1.36402 WP_002901255.1.3644 WP_002901255.1.36468 WP_002901255.1.36483 WP_002901255.1.36659 WP_002901255.1.36825 WP_002901255.1.36849 WP_002901255.1.37066 WP_002901255.1.37140 WP_002901255.1.3716 WP_002901255.1.37171 WP_002901255.1.37177 WP_002901255.1.37238 WP_002901255.1.37279 WP_002901255.1.37286 WP_002901255.1.3738 WP_002901255.1.37391 WP_002901255.1.37422 WP_002901255.1.37438 WP_002901255.1.37456 WP_002901255.1.37565 WP_002901255.1.37614 WP_002901255.1.37681 WP_002901255.1.37829 WP_002901255.1.38008 WP_002901255.1.38094 WP_002901255.1.38096 WP_002901255.1.38179 WP_002901255.1.38215 WP_002901255.1.38231 WP_002901255.1.38236 WP_002901255.1.38269 WP_002901255.1.38399 WP_002901255.1.38433 WP_002901255.1.38448 WP_002901255.1.38464 WP_002901255.1.3862 WP_002901255.1.38684 WP_002901255.1.38700 WP_002901255.1.38705 WP_002901255.1.38729 WP_002901255.1.38737 WP_002901255.1.38799 WP_002901255.1.388 WP_002901255.1.38838 WP_002901255.1.38849 WP_002901255.1.38921 WP_002901255.1.38970 WP_002901255.1.39101 WP_002901255.1.39149 WP_002901255.1.39169 WP_002901255.1.39391 WP_002901255.1.39456 WP_002901255.1.39482 WP_002901255.1.39498 WP_002901255.1.39532 WP_002901255.1.39637 WP_002901255.1.39698 WP_002901255.1.39815 WP_002901255.1.3982 WP_002901255.1.39878 WP_002901255.1.3988 WP_002901255.1.3992 WP_002901255.1.4 WP_002901255.1.40078 WP_002901255.1.40145 WP_002901255.1.40185 WP_002901255.1.40201 WP_002901255.1.40295 WP_002901255.1.40394 WP_002901255.1.40396 WP_002901255.1.40527 WP_002901255.1.40551 WP_002901255.1.40561 WP_002901255.1.40597 WP_002901255.1.40604 WP_002901255.1.40614 WP_002901255.1.4064 WP_002901255.1.40675 WP_002901255.1.4069 WP_002901255.1.40817 WP_002901255.1.40825 WP_002901255.1.40866 WP_002901255.1.40878 WP_002901255.1.40967 WP_002901255.1.4098 WP_002901255.1.41003 WP_002901255.1.41049 WP_002901255.1.41073 WP_002901255.1.41096 WP_002901255.1.41159 WP_002901255.1.41182 WP_002901255.1.41221 WP_002901255.1.41282 WP_002901255.1.41283 WP_002901255.1.41336 WP_002901255.1.41352 WP_002901255.1.414 WP_002901255.1.41405 WP_002901255.1.4154 WP_002901255.1.41563 WP_002901255.1.41630 WP_002901255.1.41644 WP_002901255.1.41669 WP_002901255.1.4167 WP_002901255.1.41702 WP_002901255.1.41713 WP_002901255.1.41765 WP_002901255.1.41794 WP_002901255.1.41895 WP_002901255.1.41924 WP_002901255.1.41928 WP_002901255.1.41930 WP_002901255.1.42054 WP_002901255.1.42079 WP_002901255.1.42139 WP_002901255.1.42153 WP_002901255.1.42264 WP_002901255.1.42297 WP_002901255.1.42306 WP_002901255.1.42476 WP_002901255.1.42518 WP_002901255.1.42578 WP_002901255.1.42584 WP_002901255.1.42629 WP_002901255.1.42724 WP_002901255.1.4286 WP_002901255.1.42881 WP_002901255.1.42929 WP_002901255.1.43010 WP_002901255.1.43084 WP_002901255.1.4312 WP_002901255.1.43146 WP_002901255.1.43214 WP_002901255.1.43221 WP_002901255.1.43228 WP_002901255.1.43231 WP_002901255.1.43233 WP_002901255.1.43413 WP_002901255.1.43445 WP_002901255.1.43468 WP_002901255.1.43492 WP_002901255.1.4351 WP_002901255.1.43538 WP_002901255.1.4359 WP_002901255.1.43611 WP_002901255.1.43833 WP_002901255.1.43853 WP_002901255.1.43867 WP_002901255.1.43874 WP_002901255.1.4393 WP_002901255.1.43941 WP_002901255.1.44158 WP_002901255.1.44235 WP_002901255.1.44325 WP_002901255.1.44368 WP_002901255.1.44418 WP_002901255.1.44528 WP_002901255.1.44567 WP_002901255.1.44708 WP_002901255.1.44931 WP_002901255.1.44946 WP_002901255.1.45107 WP_002901255.1.45137 WP_002901255.1.45191 WP_002901255.1.45258 WP_002901255.1.45380 WP_002901255.1.45445 WP_002901255.1.45482 WP_002901255.1.45519 WP_002901255.1.45520 WP_002901255.1.45607 WP_002901255.1.45644 WP_002901255.1.45821 WP_002901255.1.45910 WP_002901255.1.45970 WP_002901255.1.46 WP_002901255.1.46006 WP_002901255.1.46130 WP_002901255.1.46134 WP_002901255.1.46175 WP_002901255.1.46199 WP_002901255.1.46221 WP_002901255.1.46260 WP_002901255.1.46327 WP_002901255.1.46384 WP_002901255.1.46397 WP_002901255.1.46455 WP_002901255.1.4655 WP_002901255.1.46561 WP_002901255.1.4664 WP_002901255.1.46776 WP_002901255.1.46782 WP_002901255.1.46838 WP_002901255.1.46890 WP_002901255.1.4697 WP_002901255.1.46971 WP_002901255.1.46985 WP_002901255.1.47007 WP_002901255.1.47027 WP_002901255.1.47104 WP_002901255.1.47165 WP_002901255.1.47199 WP_002901255.1.472 WP_002901255.1.47302 WP_002901255.1.47354 WP_002901255.1.47371 WP_002901255.1.47376 WP_002901255.1.47378 WP_002901255.1.47379 WP_002901255.1.47419 WP_002901255.1.47461 WP_002901255.1.47623 WP_002901255.1.47641 WP_002901255.1.47661 WP_002901255.1.47716 WP_002901255.1.47760 WP_002901255.1.4779 WP_002901255.1.47815 WP_002901255.1.4787 WP_002901255.1.47871 WP_002901255.1.47887 WP_002901255.1.47919 WP_002901255.1.47982 WP_002901255.1.48138 WP_002901255.1.48237 WP_002901255.1.48255 WP_002901255.1.48274 WP_002901255.1.48362 WP_002901255.1.48402 WP_002901255.1.48496 WP_002901255.1.48539 WP_002901255.1.48587 WP_002901255.1.48606 WP_002901255.1.48673 WP_002901255.1.48686 WP_002901255.1.48859 WP_002901255.1.48887 WP_002901255.1.48900 WP_002901255.1.48904 WP_002901255.1.48972 WP_002901255.1.48975 WP_002901255.1.49006 WP_002901255.1.49052 WP_002901255.1.49133 WP_002901255.1.49151 WP_002901255.1.49307 WP_002901255.1.49333 WP_002901255.1.49353 WP_002901255.1.49394 WP_002901255.1.49424 WP_002901255.1.49480 WP_002901255.1.49589 WP_002901255.1.49613 WP_002901255.1.49721 WP_002901255.1.49762 WP_002901255.1.49809 WP_002901255.1.49817 WP_002901255.1.49829 WP_002901255.1.49834 WP_002901255.1.49877 WP_002901255.1.49933 WP_002901255.1.50018 WP_002901255.1.50029 WP_002901255.1.50049 WP_002901255.1.5011 WP_002901255.1.50133 WP_002901255.1.50193 WP_002901255.1.5023 WP_002901255.1.5026 WP_002901255.1.50283 WP_002901255.1.50321 WP_002901255.1.50335 WP_002901255.1.50342 WP_002901255.1.50364 WP_002901255.1.50434 WP_002901255.1.50465 WP_002901255.1.50493 WP_002901255.1.5054 WP_002901255.1.50541 WP_002901255.1.5057 WP_002901255.1.50619 WP_002901255.1.50730 WP_002901255.1.50831 WP_002901255.1.50866 WP_002901255.1.50927 WP_002901255.1.50992 WP_002901255.1.51105 WP_002901255.1.51135 WP_002901255.1.51181 WP_002901255.1.51311 WP_002901255.1.51312 WP_002901255.1.51347 WP_002901255.1.5140 WP_002901255.1.51413 WP_002901255.1.51438 WP_002901255.1.51563 WP_002901255.1.51599 WP_002901255.1.51614 WP_002901255.1.51670 WP_002901255.1.51688 WP_002901255.1.51698 WP_002901255.1.51743 WP_002901255.1.51779 WP_002901255.1.51791 WP_002901255.1.5181 WP_002901255.1.51885 WP_002901255.1.51922 WP_002901255.1.51975 WP_002901255.1.52012 WP_002901255.1.52021 WP_002901255.1.52054 WP_002901255.1.522 WP_002901255.1.52215 WP_002901255.1.52275 WP_002901255.1.52287 WP_002901255.1.52288 WP_002901255.1.52309 WP_002901255.1.52368 WP_002901255.1.52425 WP_002901255.1.52477 WP_002901255.1.5259 WP_002901255.1.52609 WP_002901255.1.52686 WP_002901255.1.52703 WP_002901255.1.52775 WP_002901255.1.52920 WP_002901255.1.52927 WP_002901255.1.52929 WP_002901255.1.52954 WP_002901255.1.53061 WP_002901255.1.53122 WP_002901255.1.53246 WP_002901255.1.53348 WP_002901255.1.53359 WP_002901255.1.53388 WP_002901255.1.53391 WP_002901255.1.53402 WP_002901255.1.53442 WP_002901255.1.53472 WP_002901255.1.53484 WP_002901255.1.53568 WP_002901255.1.53588 WP_002901255.1.53597 WP_002901255.1.53623 WP_002901255.1.53727 WP_002901255.1.53734 WP_002901255.1.53817 WP_002901255.1.53834 WP_002901255.1.53897 WP_002901255.1.53967 WP_002901255.1.53990 WP_002901255.1.540 WP_002901255.1.54011 WP_002901255.1.54129 WP_002901255.1.54212 WP_002901255.1.54380 WP_002901255.1.54448 WP_002901255.1.54786 WP_002901255.1.548 WP_002901255.1.54959 WP_002901255.1.55032 WP_002901255.1.55048 WP_002901255.1.55050 WP_002901255.1.55171 WP_002901255.1.55228 WP_002901255.1.5535 WP_002901255.1.55351 WP_002901255.1.55364 WP_002901255.1.55382 WP_002901255.1.55448 WP_002901255.1.55455 WP_002901255.1.55577 WP_002901255.1.55580 WP_002901255.1.55632 WP_002901255.1.55648 WP_002901255.1.55658 WP_002901255.1.55741 WP_002901255.1.5576 WP_002901255.1.55801 WP_002901255.1.55863 WP_002901255.1.55869 WP_002901255.1.56017 WP_002901255.1.56104 WP_002901255.1.56117 WP_002901255.1.56118 WP_002901255.1.5622 WP_002901255.1.5634 WP_002901255.1.56484 WP_002901255.1.56551 WP_002901255.1.56604 WP_002901255.1.56674 WP_002901255.1.56750 WP_002901255.1.56897 WP_002901255.1.57112 WP_002901255.1.57139 WP_002901255.1.57200 WP_002901255.1.57310 WP_002901255.1.57365 WP_002901255.1.57435 WP_002901255.1.57455 WP_002901255.1.57475 WP_002901255.1.57497 WP_002901255.1.57501 WP_002901255.1.57618 WP_002901255.1.57624 WP_002901255.1.57643 WP_002901255.1.57648 WP_002901255.1.57662 WP_002901255.1.57716 WP_002901255.1.57747 WP_002901255.1.57877 WP_002901255.1.57886 WP_002901255.1.57940 WP_002901255.1.5797 WP_002901255.1.57993 WP_002901255.1.58028 WP_002901255.1.58099 WP_002901255.1.58118 WP_002901255.1.58134 WP_002901255.1.58224 WP_002901255.1.58280 WP_002901255.1.58307 WP_002901255.1.5831 WP_002901255.1.58399 WP_002901255.1.58426 WP_002901255.1.58466 WP_002901255.1.58479 WP_002901255.1.58579 WP_002901255.1.58631 WP_002901255.1.58752 WP_002901255.1.58771 WP_002901255.1.58865 WP_002901255.1.58873 WP_002901255.1.58914 WP_002901255.1.58945 WP_002901255.1.58994 WP_002901255.1.59015 WP_002901255.1.5903 WP_002901255.1.59031 WP_002901255.1.59042 WP_002901255.1.59074 WP_002901255.1.59222 WP_002901255.1.5951 WP_002901255.1.59557 WP_002901255.1.59616 WP_002901255.1.59661 WP_002901255.1.59705 WP_002901255.1.59708 WP_002901255.1.59729 WP_002901255.1.59743 WP_002901255.1.5975 WP_002901255.1.59796 WP_002901255.1.59840 WP_002901255.1.59865 WP_002901255.1.59873 WP_002901255.1.59936 WP_002901255.1.59996 WP_002901255.1.60038 WP_002901255.1.60276 WP_002901255.1.60283 WP_002901255.1.60372 WP_002901255.1.60416 WP_002901255.1.6042 WP_002901255.1.60483 WP_002901255.1.60511 WP_002901255.1.60534 WP_002901255.1.60564 WP_002901255.1.60587 WP_002901255.1.60611 WP_002901255.1.60681 WP_002901255.1.60745 WP_002901255.1.60774 WP_002901255.1.60830 WP_002901255.1.60861 WP_002901255.1.6089 WP_002901255.1.60905 WP_002901255.1.60964 WP_002901255.1.60995 WP_002901255.1.61061 WP_002901255.1.61178 WP_002901255.1.6122 WP_002901255.1.61272 WP_002901255.1.61416 WP_002901255.1.61556 WP_002901255.1.61572 WP_002901255.1.61618 WP_002901255.1.61640 WP_002901255.1.61672 WP_002901255.1.61775 WP_002901255.1.6180 WP_002901255.1.61812 WP_002901255.1.61898 WP_002901255.1.61994 WP_002901255.1.620 WP_002901255.1.62050 WP_002901255.1.62082 WP_002901255.1.62090 WP_002901255.1.62111 WP_002901255.1.62126 WP_002901255.1.62188 WP_002901255.1.62226 WP_002901255.1.62234 WP_002901255.1.62278 WP_002901255.1.62292 WP_002901255.1.62306 WP_002901255.1.62400 WP_002901255.1.62452 WP_002901255.1.62473 WP_002901255.1.62501 WP_002901255.1.62520 WP_002901255.1.62560 WP_002901255.1.62579 WP_002901255.1.62603 WP_002901255.1.6265 WP_002901255.1.62664 WP_002901255.1.62733 WP_002901255.1.62734 WP_002901255.1.62760 WP_002901255.1.6302 WP_002901255.1.63098 WP_002901255.1.6315 WP_002901255.1.63164 WP_002901255.1.63309 WP_002901255.1.63395 WP_002901255.1.63404 WP_002901255.1.6346 WP_002901255.1.6347 WP_002901255.1.63485 WP_002901255.1.63552 WP_002901255.1.63750 WP_002901255.1.63785 WP_002901255.1.6379 WP_002901255.1.63802 WP_002901255.1.6391 WP_002901255.1.63972 WP_002901255.1.64001 WP_002901255.1.6401 WP_002901255.1.64099 WP_002901255.1.64114 WP_002901255.1.64140 WP_002901255.1.64143 WP_002901255.1.64187 WP_002901255.1.64211 WP_002901255.1.64240 WP_002901255.1.64339 WP_002901255.1.64348 WP_002901255.1.64453 WP_002901255.1.64484 WP_002901255.1.64593 WP_002901255.1.64620 WP_002901255.1.64735 WP_002901255.1.6476 WP_002901255.1.64768 WP_002901255.1.64826 WP_002901255.1.64841 WP_002901255.1.64865 WP_002901255.1.65021 WP_002901255.1.65042 WP_002901255.1.65043 WP_002901255.1.65077 WP_002901255.1.65108 WP_002901255.1.65166 WP_002901255.1.65215 WP_002901255.1.65254 WP_002901255.1.65398 WP_002901255.1.65421 WP_002901255.1.65436 WP_002901255.1.65530 WP_002901255.1.65603 WP_002901255.1.65723 WP_002901255.1.65745 WP_002901255.1.65766 WP_002901255.1.65813 WP_002901255.1.6591 WP_002901255.1.660 WP_002901255.1.66019 WP_002901255.1.66020 WP_002901255.1.66047 WP_002901255.1.66070 WP_002901255.1.66080 WP_002901255.1.6610 WP_002901255.1.66117 WP_002901255.1.66236 WP_002901255.1.66292 WP_002901255.1.66294 WP_002901255.1.66339 WP_002901255.1.66409 WP_002901255.1.66415 WP_002901255.1.66430 WP_002901255.1.66434 WP_002901255.1.6644 WP_002901255.1.66481 WP_002901255.1.66555 WP_002901255.1.66568 WP_002901255.1.66597 WP_002901255.1.66613 WP_002901255.1.66670 WP_002901255.1.66709 WP_002901255.1.66714 WP_002901255.1.66740 WP_002901255.1.66753 WP_002901255.1.6678 WP_002901255.1.66839 WP_002901255.1.66930 WP_002901255.1.66947 WP_002901255.1.66989 WP_002901255.1.67313 WP_002901255.1.6737 WP_002901255.1.67399 WP_002901255.1.67492 WP_002901255.1.67512 WP_002901255.1.6754 WP_002901255.1.67591 WP_002901255.1.67765 WP_002901255.1.67766 WP_002901255.1.6779 WP_002901255.1.67805 WP_002901255.1.67855 WP_002901255.1.67858 WP_002901255.1.67916 WP_002901255.1.67929 WP_002901255.1.67946 WP_002901255.1.68173 WP_002901255.1.68189 WP_002901255.1.6823 WP_002901255.1.68403 WP_002901255.1.68507 WP_002901255.1.68511 WP_002901255.1.68519 WP_002901255.1.68533 WP_002901255.1.68659 WP_002901255.1.6868 WP_002901255.1.68768 WP_002901255.1.68844 WP_002901255.1.6885 WP_002901255.1.68891 WP_002901255.1.68940 WP_002901255.1.68946 WP_002901255.1.68969 WP_002901255.1.68986 WP_002901255.1.69002 WP_002901255.1.69027 WP_002901255.1.69028 WP_002901255.1.69055 WP_002901255.1.6912 WP_002901255.1.69153 WP_002901255.1.69384 WP_002901255.1.69459 WP_002901255.1.69576 WP_002901255.1.69595 WP_002901255.1.69613 WP_002901255.1.69635 WP_002901255.1.69637 WP_002901255.1.69691 WP_002901255.1.69719 WP_002901255.1.69738 WP_002901255.1.69753 WP_002901255.1.69755 WP_002901255.1.69814 WP_002901255.1.69836 WP_002901255.1.69861 WP_002901255.1.69947 WP_002901255.1.7000 WP_002901255.1.70050 WP_002901255.1.70101 WP_002901255.1.70112 WP_002901255.1.70140 WP_002901255.1.702 WP_002901255.1.70499 WP_002901255.1.70543 WP_002901255.1.70718 WP_002901255.1.7072 WP_002901255.1.70765 WP_002901255.1.70847 WP_002901255.1.7087 WP_002901255.1.70870 WP_002901255.1.70873 WP_002901255.1.70966 WP_002901255.1.71056 WP_002901255.1.71092 WP_002901255.1.71100 WP_002901255.1.71212 WP_002901255.1.71296 WP_002901255.1.71387 WP_002901255.1.71393 WP_002901255.1.71504 WP_002901255.1.71611 WP_002901255.1.7168 WP_002901255.1.71704 WP_002901255.1.71720 WP_002901255.1.71751 WP_002901255.1.71804 WP_002901255.1.71838 WP_002901255.1.71913 WP_002901255.1.71990 WP_002901255.1.72154 WP_002901255.1.72201 WP_002901255.1.72214 WP_002901255.1.7223 WP_002901255.1.72274 WP_002901255.1.72341 WP_002901255.1.72406 WP_002901255.1.72609 WP_002901255.1.72632 WP_002901255.1.72673 WP_002901255.1.7273 WP_002901255.1.72735 WP_002901255.1.72746 WP_002901255.1.72765 WP_002901255.1.72899 WP_002901255.1.73038 WP_002901255.1.7320 WP_002901255.1.73208 WP_002901255.1.73236 WP_002901255.1.73301 WP_002901255.1.73316 WP_002901255.1.73319 WP_002901255.1.73472 WP_002901255.1.73510 WP_002901255.1.73558 WP_002901255.1.73589 WP_002901255.1.73635 WP_002901255.1.73691 WP_002901255.1.73742 WP_002901255.1.73770 WP_002901255.1.73780 WP_002901255.1.73887 WP_002901255.1.7390 WP_002901255.1.73904 WP_002901255.1.740 WP_002901255.1.74048 WP_002901255.1.74110 WP_002901255.1.74176 WP_002901255.1.74256 WP_002901255.1.74263 WP_002901255.1.74332 WP_002901255.1.74357 WP_002901255.1.74394 WP_002901255.1.74447 WP_002901255.1.7455 WP_002901255.1.74692 WP_002901255.1.747 WP_002901255.1.74715 WP_002901255.1.74732 WP_002901255.1.74788 WP_002901255.1.74817 WP_002901255.1.74839 WP_002901255.1.74847 WP_002901255.1.74919 WP_002901255.1.7493 WP_002901255.1.74981 WP_002901255.1.750 WP_002901255.1.75005 WP_002901255.1.75007 WP_002901255.1.75013 WP_002901255.1.75035 WP_002901255.1.7510 WP_002901255.1.75152 WP_002901255.1.75283 WP_002901255.1.75366 WP_002901255.1.75396 WP_002901255.1.75398 WP_002901255.1.75418 WP_002901255.1.75457 WP_002901255.1.75561 WP_002901255.1.75572 WP_002901255.1.75592 WP_002901255.1.75637 WP_002901255.1.7574 WP_002901255.1.7578 WP_002901255.1.75784 WP_002901255.1.75829 WP_002901255.1.75888 WP_002901255.1.75909 WP_002901255.1.75962 WP_002901255.1.7623 WP_002901255.1.76245 WP_002901255.1.76292 WP_002901255.1.7631 WP_002901255.1.76370 WP_002901255.1.76412 WP_002901255.1.76496 WP_002901255.1.76512 WP_002901255.1.76537 WP_002901255.1.76561 WP_002901255.1.76607 WP_002901255.1.76657 WP_002901255.1.76819 WP_002901255.1.76832 WP_002901255.1.76889 WP_002901255.1.76935 WP_002901255.1.76943 WP_002901255.1.77034 WP_002901255.1.77077 WP_002901255.1.77085 WP_002901255.1.77105 WP_002901255.1.77211 WP_002901255.1.7730 WP_002901255.1.77307 WP_002901255.1.77340 WP_002901255.1.77367 WP_002901255.1.77467 WP_002901255.1.77519 WP_002901255.1.77545 WP_002901255.1.77547 WP_002901255.1.77645 WP_002901255.1.77655 WP_002901255.1.77696 WP_002901255.1.777 WP_002901255.1.77723 WP_002901255.1.7773 WP_002901255.1.77799 WP_002901255.1.77800 WP_002901255.1.77802 WP_002901255.1.77831 WP_002901255.1.78001 WP_002901255.1.78103 WP_002901255.1.7811 WP_002901255.1.78171 WP_002901255.1.78214 WP_002901255.1.78260 WP_002901255.1.78268 WP_002901255.1.78300 WP_002901255.1.78387 WP_002901255.1.78417 WP_002901255.1.78418 WP_002901255.1.78421 WP_002901255.1.78534 WP_002901255.1.78540 WP_002901255.1.7858 WP_002901255.1.78613 WP_002901255.1.78725 WP_002901255.1.78745 WP_002901255.1.78772 WP_002901255.1.78922 WP_002901255.1.78950 WP_002901255.1.78962 WP_002901255.1.78981 WP_002901255.1.79021 WP_002901255.1.79091 WP_002901255.1.79108 WP_002901255.1.79109 WP_002901255.1.79141 WP_002901255.1.79175 WP_002901255.1.79211 WP_002901255.1.79236 WP_002901255.1.79266 WP_002901255.1.79420 WP_002901255.1.79541 WP_002901255.1.79582 WP_002901255.1.79599 WP_002901255.1.79608 WP_002901255.1.79636 WP_002901255.1.7974 WP_002901255.1.79756 WP_002901255.1.79857 WP_002901255.1.79868 WP_002901255.1.8001 WP_002901255.1.80027 WP_002901255.1.80047 WP_002901255.1.80062 WP_002901255.1.80227 WP_002901255.1.80350 WP_002901255.1.80362 WP_002901255.1.80412 WP_002901255.1.8054 WP_002901255.1.80554 WP_002901255.1.8056 WP_002901255.1.807 WP_002901255.1.80767 WP_002901255.1.80771 WP_002901255.1.80772 WP_002901255.1.80816 WP_002901255.1.80829 WP_002901255.1.81139 WP_002901255.1.81144 WP_002901255.1.81159 WP_002901255.1.81191 WP_002901255.1.81235 WP_002901255.1.81255 WP_002901255.1.81282 WP_002901255.1.81329 WP_002901255.1.81350 WP_002901255.1.81431 WP_002901255.1.81449 WP_002901255.1.81452 WP_002901255.1.81488 WP_002901255.1.81544 WP_002901255.1.81569 WP_002901255.1.81659 WP_002901255.1.81675 WP_002901255.1.81683 WP_002901255.1.81744 WP_002901255.1.81759 WP_002901255.1.81835 WP_002901255.1.81841 WP_002901255.1.81851 WP_002901255.1.81908 WP_002901255.1.82003 WP_002901255.1.82022 WP_002901255.1.82034 WP_002901255.1.82211 WP_002901255.1.82299 WP_002901255.1.82367 WP_002901255.1.82399 WP_002901255.1.82446 WP_002901255.1.8252 WP_002901255.1.82659 WP_002901255.1.82704 WP_002901255.1.82769 WP_002901255.1.82795 WP_002901255.1.82939 WP_002901255.1.8296 WP_002901255.1.82963 WP_002901255.1.83022 WP_002901255.1.83076 WP_002901255.1.83117 WP_002901255.1.8320 WP_002901255.1.83263 WP_002901255.1.83300 WP_002901255.1.83337 WP_002901255.1.83379 WP_002901255.1.83387 WP_002901255.1.83556 WP_002901255.1.83608 WP_002901255.1.83691 WP_002901255.1.83746 WP_002901255.1.83872 WP_002901255.1.83948 WP_002901255.1.84066 WP_002901255.1.84224 WP_002901255.1.84309 WP_002901255.1.84315 WP_002901255.1.8448 WP_002901255.1.84502 WP_002901255.1.84549 WP_002901255.1.84553 WP_002901255.1.84560 WP_002901255.1.84569 WP_002901255.1.84627 WP_002901255.1.8464 WP_002901255.1.84681 WP_002901255.1.84737 WP_002901255.1.84787 WP_002901255.1.84801 WP_002901255.1.84900 WP_002901255.1.85005 WP_002901255.1.85010 WP_002901255.1.85063 WP_002901255.1.85115 WP_002901255.1.85191 WP_002901255.1.85193 WP_002901255.1.85390 WP_002901255.1.85423 WP_002901255.1.8549 WP_002901255.1.85523 WP_002901255.1.85564 WP_002901255.1.85571 WP_002901255.1.85702 WP_002901255.1.85731 WP_002901255.1.85761 WP_002901255.1.85783 WP_002901255.1.858 WP_002901255.1.85805 WP_002901255.1.85812 WP_002901255.1.85877 WP_002901255.1.85954 WP_002901255.1.85957 WP_002901255.1.85965 WP_002901255.1.85970 WP_002901255.1.85985 WP_002901255.1.86031 WP_002901255.1.86074 WP_002901255.1.86169 WP_002901255.1.86194 WP_002901255.1.86339 WP_002901255.1.86528 WP_002901255.1.86533 WP_002901255.1.86556 WP_002901255.1.86668 WP_002901255.1.8667 WP_002901255.1.8668 WP_002901255.1.86737 WP_002901255.1.86778 WP_002901255.1.86835 WP_002901255.1.86932 WP_002901255.1.86946 WP_002901255.1.87 WP_002901255.1.87027 WP_002901255.1.87063 WP_002901255.1.87113 WP_002901255.1.87130 WP_002901255.1.87150 WP_002901255.1.87202 WP_002901255.1.87212 WP_002901255.1.87214 WP_002901255.1.87235 WP_002901255.1.87256 WP_002901255.1.87315 WP_002901255.1.87343 WP_002901255.1.87354 WP_002901255.1.87392 WP_002901255.1.87402 WP_002901255.1.87437 WP_002901255.1.87441 WP_002901255.1.87591 WP_002901255.1.87628 WP_002901255.1.8763 WP_002901255.1.87638 WP_002901255.1.87693 WP_002901255.1.87702 WP_002901255.1.87767 WP_002901255.1.87793 WP_002901255.1.87907 WP_002901255.1.87929 WP_002901255.1.87962 WP_002901255.1.88041 WP_002901255.1.88186 WP_002901255.1.88298 WP_002901255.1.8832 WP_002901255.1.88406 WP_002901255.1.88419 WP_002901255.1.8851 WP_002901255.1.8853 WP_002901255.1.88568 WP_002901255.1.88615 WP_002901255.1.88645 WP_002901255.1.88702 WP_002901255.1.88870 WP_002901255.1.88875 WP_002901255.1.88885 WP_002901255.1.89096 WP_002901255.1.89115 WP_002901255.1.89118 WP_002901255.1.89185 WP_002901255.1.892 WP_002901255.1.89226 WP_002901255.1.89300 WP_002901255.1.89326 WP_002901255.1.89327 WP_002901255.1.89340 WP_002901255.1.89430 WP_002901255.1.8952 WP_002901255.1.89524 WP_002901255.1.89593 WP_002901255.1.89602 WP_002901255.1.89618 WP_002901255.1.8966 WP_002901255.1.89688 WP_002901255.1.89692 WP_002901255.1.89722 WP_002901255.1.8983 WP_002901255.1.89919 WP_002901255.1.89961 WP_002901255.1.8999 WP_002901255.1.89991 WP_002901255.1.90020 WP_002901255.1.90051 WP_002901255.1.9012 WP_002901255.1.90123 WP_002901255.1.90297 WP_002901255.1.90318 WP_002901255.1.90355 WP_002901255.1.90374 WP_002901255.1.90382 WP_002901255.1.90383 WP_002901255.1.90424 WP_002901255.1.90446 WP_002901255.1.90469 WP_002901255.1.90493 WP_002901255.1.90516 WP_002901255.1.90636 WP_002901255.1.90662 WP_002901255.1.90699 WP_002901255.1.90802 WP_002901255.1.90870 WP_002901255.1.90879 WP_002901255.1.90904 WP_002901255.1.9092 WP_002901255.1.90993 WP_002901255.1.91001 WP_002901255.1.91033 WP_002901255.1.91134 WP_002901255.1.91181 WP_002901255.1.91187 WP_002901255.1.91298 WP_002901255.1.91301 WP_002901255.1.91319 WP_002901255.1.91385 WP_002901255.1.91402 WP_002901255.1.91415 WP_002901255.1.91444 WP_002901255.1.91452 WP_002901255.1.91461 WP_002901255.1.91522 WP_002901255.1.91534 WP_002901255.1.91544 WP_002901255.1.91550 WP_002901255.1.91604 WP_002901255.1.91613 WP_002901255.1.91676 WP_002901255.1.91678 WP_002901255.1.91684 WP_002901255.1.9170 WP_002901255.1.91725 WP_002901255.1.91729 WP_002901255.1.91741 WP_002901255.1.91751 WP_002901255.1.918 WP_002901255.1.91842 WP_002901255.1.91847 WP_002901255.1.92020 WP_002901255.1.92035 WP_002901255.1.92046 WP_002901255.1.92066 WP_002901255.1.92084 WP_002901255.1.92117 WP_002901255.1.9216 WP_002901255.1.92174 WP_002901255.1.92209 WP_002901255.1.92280 WP_002901255.1.92460 WP_002901255.1.92569 WP_002901255.1.9258 WP_002901255.1.9259 WP_002901255.1.92601 WP_002901255.1.92608 WP_002901255.1.92704 WP_002901255.1.92771 WP_002901255.1.92873 WP_002901255.1.92901 WP_002901255.1.9300 WP_002901255.1.93004 WP_002901255.1.93070 WP_002901255.1.93081 WP_002901255.1.93131 WP_002901255.1.93132 WP_002901255.1.93161 WP_002901255.1.93226 WP_002901255.1.93256 WP_002901255.1.93278 WP_002901255.1.93342 WP_002901255.1.93685 WP_002901255.1.93757 WP_002901255.1.9383 WP_002901255.1.94200 WP_002901255.1.94216 WP_002901255.1.94290 WP_002901255.1.94493 WP_002901255.1.94599 WP_002901255.1.94605 WP_002901255.1.94608 WP_002901255.1.94642 WP_002901255.1.94696 WP_002901255.1.94721 WP_002901255.1.94777 WP_002901255.1.94837 WP_002901255.1.94860 WP_002901255.1.94871 WP_002901255.1.94894 WP_002901255.1.9492 WP_002901255.1.95021 WP_002901255.1.95030 WP_002901255.1.95122 WP_002901255.1.95189 WP_002901255.1.9521 WP_002901255.1.95238 WP_002901255.1.95349 WP_002901255.1.95408 WP_002901255.1.95429 WP_002901255.1.95524 WP_002901255.1.95527 WP_002901255.1.95697 WP_002901255.1.95743 WP_002901255.1.95754 WP_002901255.1.95775 WP_002901255.1.95843 WP_002901255.1.95889 WP_002901255.1.95898 WP_002901255.1.95927 WP_002901255.1.96010 WP_002901255.1.96202 WP_002901255.1.96225 WP_002901255.1.9626 WP_002901255.1.96374 WP_002901255.1.96375 WP_002901255.1.96383 WP_002901255.1.9651 WP_002901255.1.96645 WP_002901255.1.96653 WP_002901255.1.96684 WP_002901255.1.96774 WP_002901255.1.96793 WP_002901255.1.96802 WP_002901255.1.96842 WP_002901255.1.96881 WP_002901255.1.96915 WP_002901255.1.97025 WP_002901255.1.97092 WP_002901255.1.97114 WP_002901255.1.97197 WP_002901255.1.97236 WP_002901255.1.97273 WP_002901255.1.97294 WP_002901255.1.97333 WP_002901255.1.97353 WP_002901255.1.97416 WP_002901255.1.97419 WP_002901255.1.9745 WP_002901255.1.97463 WP_002901255.1.97475 WP_002901255.1.97500 WP_002901255.1.97567 WP_002901255.1.97636 WP_002901255.1.97680 WP_002901255.1.97697 WP_002901255.1.97728 WP_002901255.1.97734 WP_002901255.1.97759 WP_002901255.1.97773 WP_002901255.1.97794 WP_002901255.1.97833 WP_002901255.1.97855 WP_002901255.1.9800 WP_002901255.1.98016 WP_002901255.1.98125 WP_002901255.1.98278 WP_002901255.1.98311 WP_002901255.1.98320 WP_002901255.1.98336 WP_002901255.1.98342 WP_002901255.1.98408 WP_002901255.1.98420 WP_002901255.1.98450 WP_002901255.1.98673 WP_002901255.1.98728 WP_002901255.1.9875 WP_002901255.1.98774 WP_002901255.1.98794 WP_002901255.1.98816 WP_002901255.1.98871 WP_002901255.1.98932 WP_002901255.1.99007 WP_002901255.1.99013 WP_002901255.1.99016 WP_002901255.1.99166 WP_002901255.1.99245 WP_002901255.1.99248 WP_002901255.1.99264 WP_002901255.1.99279 WP_002901255.1.99305 WP_002901255.1.99439 WP_002901255.1.99691 WP_002901255.1.99705 WP_002901255.1.99706 WP_002901255.1.99778 WP_002901255.1.99873 WP_002901255.1.99885 WP_002901255.1.99944 WP_002901255.1.9996 YP_005226384.1.24690 gi|402781235|ref|YP_006636781.1| gi|378978243|ref|YP_005226384.1| gi|386034389|ref|YP_005954302.1| 272620.KPN_01201 gi|152969755|ref|YP_001334864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]