SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386036668|ref|YP_005956581.1| from Klebsiella pneumoniae KCTC 2242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386036668|ref|YP_005956581.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.62e-108
Family FMN-linked oxidoreductases 0.0000000000634
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.35e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000152
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.51e-24
Family C-terminal domain of adrenodoxin reductase-like 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386036668|ref|YP_005956581.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Klebsiella pneumoniae KCTC 2242]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEILTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYARRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKVTSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFAVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTTDDLLAFDETILATGIAPRLPAIDGIDHP
KVLSYLDVLRDKAPVGAKVAIIGCGGIGFDTAMFLSQSGVATSQDIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences A0A169WNS8
WP_004900808.1.100385 WP_004900808.1.10291 WP_004900808.1.10681 WP_004900808.1.11210 WP_004900808.1.11957 WP_004900808.1.12237 WP_004900808.1.12445 WP_004900808.1.12983 WP_004900808.1.13541 WP_004900808.1.14407 WP_004900808.1.14594 WP_004900808.1.1500 WP_004900808.1.15320 WP_004900808.1.15339 WP_004900808.1.15878 WP_004900808.1.16326 WP_004900808.1.16559 WP_004900808.1.1702 WP_004900808.1.17921 WP_004900808.1.17930 WP_004900808.1.18241 WP_004900808.1.18431 WP_004900808.1.1986 WP_004900808.1.19989 WP_004900808.1.20050 WP_004900808.1.20685 WP_004900808.1.21936 WP_004900808.1.22072 WP_004900808.1.22534 WP_004900808.1.22712 WP_004900808.1.2272 WP_004900808.1.23609 WP_004900808.1.25163 WP_004900808.1.25275 WP_004900808.1.25563 WP_004900808.1.26067 WP_004900808.1.27488 WP_004900808.1.28152 WP_004900808.1.28640 WP_004900808.1.29334 WP_004900808.1.30300 WP_004900808.1.30339 WP_004900808.1.30426 WP_004900808.1.3138 WP_004900808.1.31459 WP_004900808.1.31591 WP_004900808.1.32300 WP_004900808.1.32612 WP_004900808.1.33229 WP_004900808.1.34258 WP_004900808.1.34481 WP_004900808.1.34507 WP_004900808.1.34654 WP_004900808.1.34681 WP_004900808.1.34757 WP_004900808.1.35109 WP_004900808.1.35645 WP_004900808.1.35918 WP_004900808.1.36151 WP_004900808.1.36728 WP_004900808.1.37860 WP_004900808.1.38700 WP_004900808.1.38815 WP_004900808.1.38838 WP_004900808.1.39149 WP_004900808.1.39299 WP_004900808.1.39360 WP_004900808.1.39482 WP_004900808.1.39677 WP_004900808.1.41405 WP_004900808.1.41872 WP_004900808.1.41907 WP_004900808.1.42299 WP_004900808.1.42476 WP_004900808.1.42584 WP_004900808.1.42755 WP_004900808.1.43221 WP_004900808.1.43601 WP_004900808.1.43833 WP_004900808.1.43853 WP_004900808.1.43941 WP_004900808.1.44528 WP_004900808.1.45327 WP_004900808.1.45557 WP_004900808.1.45594 WP_004900808.1.47777 WP_004900808.1.48022 WP_004900808.1.48606 WP_004900808.1.48609 WP_004900808.1.48893 WP_004900808.1.4900 WP_004900808.1.49035 WP_004900808.1.49438 WP_004900808.1.49933 WP_004900808.1.5054 WP_004900808.1.51438 WP_004900808.1.51698 WP_004900808.1.5181 WP_004900808.1.52012 WP_004900808.1.52678 WP_004900808.1.52920 WP_004900808.1.53461 WP_004900808.1.53716 WP_004900808.1.54045 WP_004900808.1.54739 WP_004900808.1.548 WP_004900808.1.54824 WP_004900808.1.54952 WP_004900808.1.5535 WP_004900808.1.55866 WP_004900808.1.57310 WP_004900808.1.57886 WP_004900808.1.58479 WP_004900808.1.58594 WP_004900808.1.58967 WP_004900808.1.59074 WP_004900808.1.59172 WP_004900808.1.59518 WP_004900808.1.59557 WP_004900808.1.59559 WP_004900808.1.59796 WP_004900808.1.59924 WP_004900808.1.60372 WP_004900808.1.60922 WP_004900808.1.61898 WP_004900808.1.61973 WP_004900808.1.62090 WP_004900808.1.62126 WP_004900808.1.62188 WP_004900808.1.62560 WP_004900808.1.63123 WP_004900808.1.6346 WP_004900808.1.64620 WP_004900808.1.64735 WP_004900808.1.64768 WP_004900808.1.64826 WP_004900808.1.64945 WP_004900808.1.65166 WP_004900808.1.65254 WP_004900808.1.65723 WP_004900808.1.65813 WP_004900808.1.66236 WP_004900808.1.66271 WP_004900808.1.66555 WP_004900808.1.66577 WP_004900808.1.66857 WP_004900808.1.67399 WP_004900808.1.67855 WP_004900808.1.67936 WP_004900808.1.68403 WP_004900808.1.69268 WP_004900808.1.69459 WP_004900808.1.69947 WP_004900808.1.70519 WP_004900808.1.70550 WP_004900808.1.70666 WP_004900808.1.70681 WP_004900808.1.70966 WP_004900808.1.71056 WP_004900808.1.7136 WP_004900808.1.71611 WP_004900808.1.7168 WP_004900808.1.71704 WP_004900808.1.71720 WP_004900808.1.71751 WP_004900808.1.72154 WP_004900808.1.72713 WP_004900808.1.73319 WP_004900808.1.73635 WP_004900808.1.73689 WP_004900808.1.7390 WP_004900808.1.74332 WP_004900808.1.74394 WP_004900808.1.74905 WP_004900808.1.74909 WP_004900808.1.7510 WP_004900808.1.75398 WP_004900808.1.75888 WP_004900808.1.76245 WP_004900808.1.76657 WP_004900808.1.7733 WP_004900808.1.78012 WP_004900808.1.78065 WP_004900808.1.78171 WP_004900808.1.78417 WP_004900808.1.78418 WP_004900808.1.78597 WP_004900808.1.79211 WP_004900808.1.79520 WP_004900808.1.80027 WP_004900808.1.80350 WP_004900808.1.80466 WP_004900808.1.8054 WP_004900808.1.80554 WP_004900808.1.80615 WP_004900808.1.80772 WP_004900808.1.81139 WP_004900808.1.81255 WP_004900808.1.81633 WP_004900808.1.81851 WP_004900808.1.82129 WP_004900808.1.82170 WP_004900808.1.82370 WP_004900808.1.82452 WP_004900808.1.8252 WP_004900808.1.83608 WP_004900808.1.84549 WP_004900808.1.84783 WP_004900808.1.84890 WP_004900808.1.85877 WP_004900808.1.86533 WP_004900808.1.86932 WP_004900808.1.87202 WP_004900808.1.87354 WP_004900808.1.87441 WP_004900808.1.87631 WP_004900808.1.87702 WP_004900808.1.88274 WP_004900808.1.88574 WP_004900808.1.88615 WP_004900808.1.88875 WP_004900808.1.8896 WP_004900808.1.89110 WP_004900808.1.89118 WP_004900808.1.89185 WP_004900808.1.89558 WP_004900808.1.90142 WP_004900808.1.90424 WP_004900808.1.91181 WP_004900808.1.91684 WP_004900808.1.92035 WP_004900808.1.92174 WP_004900808.1.92704 WP_004900808.1.92746 WP_004900808.1.94033 WP_004900808.1.94200 WP_004900808.1.94518 WP_004900808.1.94701 WP_004900808.1.94777 WP_004900808.1.94837 WP_004900808.1.95299 WP_004900808.1.95405 WP_004900808.1.97759 WP_004900808.1.99013 WP_004900808.1.9934 WP_004900808.1.99794 gi|386036668|ref|YP_005956581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]