SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SARC_04788T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_04788T0
Domain Number 1 Region: 79-179
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.77e-29
Family 2Fe-2S ferredoxin-related 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SARC_04788T0
Sequence length 193
Comment | SARC_04788 | Sphaeroforma arctica JP610 hypothetical protein (194 aa)
Sequence
MFLGTLASICTGSVARASRQSQMARRCFFGDLTRSVNGSGLRAATQGVVFRSAFHTRIGG
LRHGDFEWEDPKSEDEVVNVSVILRDGTEKVIRGKVGDNLLYLCHRYDVPMEGACEASLA
CSTCHVYVDEDYLDTLPEAEEEEEDMLDMAVQLKENSRLGCQIRLTKELEGLKVELPKAT
RNFYVDGHVPTPH
Download sequence
Identical sequences A0A0L0G288
XP_014156843.1.97753 SARC_04788T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]