SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SARC_05172T0 from Sphaeroforma arctica JP610

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SARC_05172T0
Domain Number 1 Region: 236-525
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.7e-86
Family Cryptochrome/photolyase FAD-binding domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 4-184
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.31e-41
Family Cryptochrome/photolyase, N-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SARC_05172T0
Sequence length 624
Comment | SARC_05172 | Sphaeroforma arctica JP610 hypothetical protein (625 aa)
Sequence
MPGAIFWFRKGLRLHDNKALIAAVESRGKKVYPVYVLDPKFVNPKQMGLNRLRFLLECLL
DLDYSLRTKHNSRLIVLRGDPTVVIPEQIEAWDVDRLVYEDEPEPHNVERDEAIKAVLKE
SNSACLVYCTPGHTIWDPKYLLKINNGKPPLTMQSFTTLAEKKADPPARPINAPTAEAMQ
LMLPRDVPETDKAEGDMYSVPVVENVKDFVALYSSLGVNGDQCTIDEADEKENNAGTPIV
KGGETEALKRLSIKVNNRHTWVATFAKPDTAPTAFDPPSTTILSPYLANGSISPRLFYYA
ILDCYEKNRKENGHAHTKSPTSLMAQLYWREFFTLCGRELPHFGAMVGNSICKQIPWSRD
MALLRAWEKSHTGFPWIDSVMTQLRTTGWIHHLARHSVACFLTRGDLWVHWEMGRDAFER
HLLDADWSLNNANWMWLSASGFFHQFYRVYSPIAWPKKTDPNGDHVRHFVPVLKDMPKKY
IYEPWLAPLTVQKKANCIIGKDYPYPVVDHNTVKNANLTKMKDAYGRHSDGKINWEEDVA
QNVSNADKVIQTTGIGEYEYVSKDTHNSGKRKAVAAPSEVDSDENTVKVEGQSSAPKKDK
AKDINSKPTRGNRSKILRQTTLEF
Download sequence
Identical sequences A0A0L0G0E7
XP_014156447.1.97753 SARC_05172T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]