SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30000113m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30000113m
Domain Number 1 Region: 126-244
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000327
Family MgtE N-terminal domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 354-472
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000419
Family MgtE N-terminal domain-like 0.026
Further Details:      
 
Weak hits

Sequence:  Sakowv30000113m
Domain Number - Region: 261-376
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00101
Family MgtE N-terminal domain-like 0.026
Further Details:      
 
Domain Number - Region: 21-136
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0484
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30000113m
Sequence length 651
Sequence
MHYSPYHNVIETKHYSPYPSVIETIHYSPYHRVIETMHYSPYHNVTETMYYSPYHSVIET
MYYSPYHSVIETMYYSPYHSVTETMHYSPYHNVTETMYHSPHHSVIETMYYSPYHSVIET
MHYSPYHNVIETMNYSPHHSVIDTMHYSPYHSVIGTMHYSPYYSVIDTMHYSPYHSVIET
MHYSLFHSVIETMHYSPYHNVIETMHYSPYHSVIETMHYSPYHRVIETMHYSPYHNVTET
MHYSPYHSATETMYYSPYHSVIETMHYSPYHSVTETMHYSPYHNVTETMYYSPYHSVIET
MYYSPYHSVIETMHYSLYHSVIETMHYSPYHNVTETMYYSPYHSVIETMYYSPYHSVIET
MHYSLFHSVIETMHYSPYHNVIETMHYSPYPSVIETIHYSPYHRVIETMHYSPYHNVTET
MYYSPYHSVIETMYYSPYHSVIETMHYSLFHSVIETMHYSPYHNVIETMHYSPYHSVIET
MHYSPYHSVTETMYYSPYHSVTETMHYSLYHSVTETKYYTPYPSVIETMHYSLYHSVTET
MHYSPYHNVTEIMYYSLFHSVIETMYYSPYHSVTEPMYYSPYQSVIETMCYSPYHSVIET
IHYSPYHNIIETMDYSPHHSVIDTMHYSPYHSVIETMHYSPYHSAIETMHY
Download sequence
Identical sequences Sakowv30000113m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]