SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30002385m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30002385m
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000188
Family MgtE N-terminal domain-like 0.0071
Further Details:      
 
Weak hits

Sequence:  Sakowv30002385m
Domain Number - Region: 697-784
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000353
Family MgtE N-terminal domain-like 0.0095
Further Details:      
 
Domain Number - Region: 301-391
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000628
Family MgtE N-terminal domain-like 0.0091
Further Details:      
 
Domain Number - Region: 385-488
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000641
Family MgtE N-terminal domain-like 0.011
Further Details:      
 
Domain Number - Region: 637-719
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00353
Family MgtE N-terminal domain-like 0.0088
Further Details:      
 
Domain Number - Region: 186-268
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00575
Family MgtE N-terminal domain-like 0.0091
Further Details:      
 
Domain Number - Region: 469-540
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00628
Family MgtE N-terminal domain-like 0.012
Further Details:      
 
Domain Number - Region: 805-882
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0549
Family MgtE N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30002385m
Sequence length 891
Sequence
MTGEGLADVLPLMTGEGLADVLPIMTGEGLADVLPLMTGEGLADVLPMMTGEGLADVLPL
MTGEGLADVLTFVTGEGLADVLPLMTGEWLADVLPLMTGEGLADVLPLMTGEGLADVLPL
MTGEGLADVLPLTTGEGLADVLQLMTGEGLADVLPLMTGEGLADVLPLMTGEGLADFQTF
VTGEGLADVLPLMTGEGLADVLPLMTGEGLADVLTFVTGEGLADVLTFVTGEGLADVLPL
MTGEGLADVLTFVTGEGLADVLTFVTGEGLADVLPFVTDVLPFVTGERLADVLTFVTGEG
LADVLTFVTGEGLADVLTFVTGEGLADVLTFVTGEGLADVLPLMTGEGLADVLPLMTGEG
IADVLPFVTGEGLADVLPFVTGEGLADVLTLMTGEGIADVLPLTTDEGLADVLSLMTGEW
LADVLTFVTGEGLADVRTFVTGEGLADVLPLMTGEGLADVLPFVTGEGLADVLPFVTGEW
LADVLPLMTGEGLADVLTFVTGEGLADVLPFVTGEGLADVLPFVTGEGLADVLPLMTGEG
LADVLPLTTGEGLADVLPLTTGEGLADVLPLMTGEGLADVLPFVTGEGLADVLPLTTGEG
LADVLPLMTGEGLADVLPLTTGEGLADVLPLTTGEGLADVLPLTTGEGLADVLPLTTGEG
LADVLPFVSGEVLADALPLMTGEGLADILPFVTGEELADVLPFVTGEGLADVLPLMTGEG
LADVLPFVTGEGLADVLPFVTGEGLADVLPLMTGEGLADVLPLMTGEGLADVLPLMTGEG
LADVLPFVTGEGLADVLPLTTGEGLADVLPLMTGEGLADVLPLTTGEGLADVLPLTTGEG
LADVLPFVSGEVLADALPLMTGEGLADVLPFVTGEELADVLPFVTFGKYRT
Download sequence
Identical sequences Sakowv30002385m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]