SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30002616m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30002616m
Domain Number 1 Region: 297-397
Classification Level Classification E-value
Superfamily Acid proteases 0.000000516
Family Retroviral protease (retropepsin) 0.035
Further Details:      
 
Weak hits

Sequence:  Sakowv30002616m
Domain Number - Region: 412-496
Classification Level Classification E-value
Superfamily dUTPase-like 0.016
Family dUTPase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30002616m
Sequence length 542
Sequence
MVENPLDTRRQDTRLSKWSEEKTLRALLLFLSGLAFDWHRNLSQRIKTTFTELETEFKTH
FRSKFPEWFVSKSLDNVKQQICQSAAEYARVLTLQIEKSNGDTDNLLITFLKGLRSEYAP
YIILKNPKTMEEALDICYEYELIAHTRQSEQTVAQLIPGVPSASANNLTTHTLSTKLDKL
QLQMGEITKHLSELQMSKDEQNITDSINHIHSQSTSHSRTPQHYQHHSDLTKSVPRFSQR
GDGYAQGRSNEVFKLPQPVTVSGGVSGSNDHNKLNPSQFPLNSIALPESHDIYFDNLINV
QIKSYNIKCLLDSGAMISFANNNIFKKIPSLRHIQRSNPTVSRVTTASGDPLKVEGVLET
SGIIGSQKVKLRLHIIPELWQDSILGQGFLAIHKVKVDYSSNKFNFQTPTTFSAAHSFAI
PPKTESIQVARLKSKLPDSLIGTTFAANHTTAKGYTTGRVLTTAKQNKIHIRILNPSDNT
VYIKKNTKLGNFCPLPSQATIVPLPESDKHPTNTPAEPNLCEDDQYLLSEIKLSESNIDS
HE
Download sequence
Identical sequences Sakowv30002616m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]