SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30008113m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30008113m
Domain Number 1 Region: 1-221
Classification Level Classification E-value
Superfamily CutC-like 1.29e-65
Family CutC-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30008113m
Sequence length 225
Sequence
MEVCVDSVESAVAAQKGGMLKVVKTECHLPVYVMIRPRGGDFSYSDYEMDVMRQDIMSVK
ACGADGIVFGVLTRRGDIDVNACRELVELSRPLEVTFHRAFDMARNPTKALEDIISLKFN
RVLTSGCDSTALEGAPVIKQLIDQAKGRIIIVPGGGINDRNLRRILEQTGAHEFHCSARK
TQDSTMMYRNTNVHMGAAFQPPEFVMKFTNTDLVVKLRDLASSDR
Download sequence
Identical sequences Sakowv30008113m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]