SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30010806m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30010806m
Domain Number - Region: 255-354
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00405
Family MgtE N-terminal domain-like 0.01
Further Details:      
 
Domain Number - Region: 160-256
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00549
Family MgtE N-terminal domain-like 0.013
Further Details:      
 
Domain Number - Region: 484-581
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00872
Family MgtE N-terminal domain-like 0.019
Further Details:      
 
Domain Number - Region: 91-186
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0157
Family MgtE N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30010806m
Sequence length 597
Sequence
MADLLNIAHHTPLADLLNIAHHTAMADLLNIAHHTAMADLLNIALHTPLADLLNIAHHTA
MADLLNIALHTPLADLLNIAHHTAMADLLNIAHHTAMADLLNVAHHTLLADLLNIAHRTA
MADLLNIAHHTAMADLLNIAHHPAMADLLNIAHHTAMADLLNIAHHTPLADLLNIAHHTA
MADLLNIAHHTAMADLLNIAHHTAMADLLNIAHHTPLADLLNIAHHTAMADLLNIAHHTA
MADLLNIAHHTAIADLLNIAHYTPLADLLNIANHTAIADLLNIAHHTAMADLLNIAHHPS
MADLLNIAHHTAMADLLNIAHHTPLADLLNIAHHTAMADLLNIAHHTAMADLLNIAHHTP
LANLLNIAHHTAITDLLNIAHHTAMADLLNIAHHTAMADLLNIAHHTPLADLLNIAHHPA
MTDLLNIAHHTAMADLLNIAHHTPLADLLNVAHHTPLADLLNIAHHTPLADLLNIAHHTA
MADLLNIAHHTAMADLLNIAHHAPLADLLNIAHHTAMADLLNIAHHTAMADLLNIAHHTP
LADLLNIAHHPAMAYLLNVTHHTPLADLLNIAYHTAMADLLNIAHDTPLAVCQFIQS
Download sequence
Identical sequences Sakowv30010806m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]