SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30012556m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30012556m
Domain Number - Region: 7-90
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00654
Family MgtE N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30012556m
Sequence length 181
Sequence
RLYIMLYNILQERLYIMLYNILQERLHNNVIQHITRKTIHNVIHHITRKTIHNVIQHITR
KTIHNVIQHITRKTIHNVIQHITRKTIHNVIQHITRLYIMLYNILQERLYIMLYIILQER
LYIMLYNILQERLYIMLYNILQERLYIMLYNILLEKLYIMLYNILQERLYIMLYNILQDY
T
Download sequence
Identical sequences Sakowv30012556m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]