SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30014345m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30014345m
Domain Number - Region: 95-185
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00196
Family MgtE N-terminal domain-like 0.023
Further Details:      
 
Domain Number - Region: 10-81
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0144
Family MgtE N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30014345m
Sequence length 193
Sequence
MNPAKQKYIPGSMNPAKQKYIPGSMNTAKQQYIPGSMNTAKQQYIFGSMNPAKQEYITGS
MTPGKHKYIPDSMNSAKHKYITGSLNLAIQNYIPAKQKYISGSMSPAKHMYITGSMNPAK
LKYIAGFLNPAKQKYIAGFLNPAKQKYIAGFLNPAKQKYIAGFLNPAKQKYIAGFLNPAK
QKYISGSLNPAIQ
Download sequence
Identical sequences Sakowv30014345m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]