SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30014346m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30014346m
Domain Number - Region: 10-81
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0122
Family MgtE N-terminal domain-like 0.02
Further Details:      
 
Domain Number - Region: 110-166
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0432
Family MgtE N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30014346m
Sequence length 181
Sequence
MNPAKQKYIPGSMNPAKQKYIPGSMNTAKQQYIPGSMNTAKQQYIFGSMNPAKQEYITGS
MTPGKHKYIPDSMNSAKHKYITGSLNLAIQNYIPAKQKYISGSMSPAKHMCITGSMNPAK
LKYIAGFLNPAKQKYIAGFLNPAKQKYIAGFLNPAKQKYIAGFLNPAKQKYISGSLNPAI
Q
Download sequence
Identical sequences Sakowv30014346m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]