SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30015108m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30015108m
Domain Number 1 Region: 150-268
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000017
Family MgtE N-terminal domain-like 0.025
Further Details:      
 
Domain Number 2 Region: 242-352
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000017
Family MgtE N-terminal domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 19-136
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000196
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30015108m
Sequence length 497
Sequence
MHYSPYYSVIETMHYSPYHSVIETMHYSPYHRVIETMHYSPYYSVIETMHYSPYHRVIET
MHYSPYHSVIETTHYSPYHSVIETMYYSPYQSVIETMHYSPYQSVIETMHYSPYHSVIDA
MHYSSYHRVIETMYYSPYHSVTEPMYYSPYHSVIETMYYSPYHSVIETIHYSPYHNVIET
MNYSPYHRVIETMRYSPYHSVIETMHYSMYHSVIETMHYSPYYSVIETMYYSPYNSVIET
MHYSPYYSVIETMHYSPYHSVIETMHYSPYHRVIETMHNSPYYIVTETMHYSPYHSVIEI
MHYSPYHSVIETMYYSPYHRVIETMDYSPYHSVIEIMHYSPYHNVIETMQYSPYHSVIET
MYYSRFHSVIETMHYSPYQSVTGTMYYSLYHSVIETMHYSLYHSVFATMHYSPYHSVIET
MHYSLYHSVNETMHYSPYHNVTEIMFYSLYHSVIETMYYSPYHSVTEPMYYSPYHSVIET
MHYSPYHSVIETVHYSP
Download sequence
Identical sequences Sakowv30015108m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]