SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30016237m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30016237m
Domain Number 1 Region: 47-159
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000222
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30016237m
Sequence length 169
Sequence
MHYSPYHSVTEPMYYSPYHSVIETMYYSPYHSVIETIHYSPYHNVIETMNYSPYHRVIET
MRFSPYHRVIETMHYSPYHSVIETMHYSPYYSVIETMHYSPYHSVIETMHYSPYYSVIET
MHYSPYHSVIETMHYSPYHRVIETMHNSPYYSVIEPMHYSPYHNVIETM
Download sequence
Identical sequences Sakowv30016237m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]