SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30016238m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30016238m
Domain Number - Region: 15-135
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00358
Family MgtE N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30016238m
Sequence length 217
Sequence
MHYSPYQSVTGTMYYSLYHSVIETMHYSLYHCVFATMHYSPYHIVIETMHYSLYHCVNET
MLYSPYHNVTEIMFYSLYHSVIETMYYSPYHSVIETMYYSPYHRVIETMHYSPYHSVIEI
MHYSPYHSVIETMYYSPYHSVVETMHYSPYHSVIETMHYSPYHSVIDAMHYSSYHSKTET
LHYSPHHSVIETMHYSLYHSVIEPMHYSPYHSAIETM
Download sequence
Identical sequences Sakowv30016238m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]