SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30023838m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30023838m
Domain Number 1 Region: 367-600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-24
Family RecA protein-like (ATPase-domain) 0.0075
Further Details:      
 
Domain Number 2 Region: 160-307
Classification Level Classification E-value
Superfamily DNA primase core 0.00000000214
Family Primase fragment of primase-helicase protein 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30023838m
Sequence length 647
Sequence
MFSKYGYLSTPSWKTLHKVVRSIKTLMLNKKSLNITVSEMRKFLKEKGFECKTGYTCLVA
KCPFCCHDNLNKAQLHMYVNMTTGSYSCECIKYNGSWDSLQDVLTASQRKKMKPIITAET
NGVNTEVKEAESLWSDVTPIKDGDEDLVAKLKQIHNMKPLTLDIMSKYDVHIQKISKSLM
FPRYHHGNTLQGIRVLGSDVSLKGRPVFTDHHLPKLDCAGLFGWNLIHADDKHIVLTGSE
ADAMAVTQATRLNALALPRGISVLPQEVLPLLEQFERILLWFGNDLRSWEAAKQFAKKLN
PRRCYFIRPKEKNPRPIEALEKQMNLNNIIKLAQPVSHKAIVSFRTLREEVLGELSHAEQ
VAGVKWSRFPLLNKLLKGHRRGELTVFTGPTGSGKTTFMSEYSLDLCSQGVNTLWGSFEI
RNVRLAKMMLTQFSKVNLESQLDLFDFWADKFENLPLYFMTFHGQQNFKLVLEAMTHAVY
VHDIEHVIVDNLQFMVGLSDRLASTDRFGLYDNIIASLRKFSTVNNCHVTVVIHPRKEKD
TEELQTASIFGSAKAAQEADNILLLQDKRLTSLRGKKYIQVAKNRFDGDLGIVPLHFSKE
SLTMSSAAGGKTPVNKDGIKKQKILNSIDKVDQVLSDDDDDDDEDDD
Download sequence
Identical sequences Sakowv30023838m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]