SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30025390m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30025390m
Domain Number 1 Region: 78-172
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000916
Family MgtE N-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00000602
Family MgtE N-terminal domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 199-277
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000131
Family MgtE N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30025390m
Sequence length 294
Sequence
MATLNRELSEDRVATLNRELSEDRMATLNRELSEDRMATLNRELSEDRVATLNRELSGDR
MATLNRELSGDRMATLNRELSEDSMATLNRELSEDRMATLNRELSEDRVATLNRELSEDR
MATINRELSEDRVATLNRELSEDRMATLNRELSEDRMATLNRELSEDSMATLNRELSEDM
MATLNRELSEDGMATLNRELSEDRMATLNRELSEDRMATLNRELSEDRMATLNRELSEDR
MATLNRELSEDRVATLNRKLSEDRMATLNRELSEDMVNILHFISNQTVQSMTSP
Download sequence
Identical sequences Sakowv30025390m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]