SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30028793m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30028793m
Domain Number - Region: 87-179
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00589
Family MgtE N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30028793m
Sequence length 302
Sequence
MSCSSVIVSMPGPHMADCFISMPGPHMADCVVSVPGPHMADCVVVSMSGPHMAVCVVSMP
GSHMVDCFVSVPGSHMADCVVTMPGPHMADFVVSMHGPHMADYVVSMPELHMAVCLVTMP
GPHMADFVVSMSGPHMADCIVTMPGPHMADFVVSMSGPHMADFVVSMSGPHMADFVVSMS
GPHMAVLSVCLVYTWLTVLSVCLVYTWLTVLSVCLVYTWLTVLSVGLIHTWLTVLSLCLV
HTWLTVLSLCLVHIWLTVLSLCLVHTWLTALSVYLVHTWLTALSVYLVHTWLTVLSVCLV
HT
Download sequence
Identical sequences Sakowv30028793m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]