SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30031826m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30031826m
Domain Number 1 Region: 74-300
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 2.35e-74
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 2-74,305-500
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.45e-72
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30031826m
Sequence length 502
Sequence
MSKVCLIVIDGWGVSDAVEGNAILHAETPVMDKLFEENAVTLNASGFSVGLPDGLMGNSE
VGHMTIGIGRIIYQDIVRINKSITEKTIFSNKALVDACNQAKQGNGRLHFLGLVSDGGVH
SHIDHLFTLLDAAKEQGVPECFVQYFADGRDTRPSSGVTFVEQLLNKMKSINYGKLATVV
GRYYAMDRDKRYERIKIAYDGLCQGLGEKTTQDQVIEVIKKRYEANETDEFLKPIIVSEE
GRVRDGDTMIFIDFRADRMREIVEAFGIQRNFDTEVAPKVNVTVMTEYKGGWPFPQLFPP
QVPTNVLGEWLAHKKVPQFHCAETEKYAHVTFFFNGGREDAFELEDRCMVPSPKVPTYDT
LPEMSSAGVADKMVEAIGSGKYPFVMCNFAPPDMVGHTGQYEPAVKACTATDIAIGRIYD
ACEKHGYVLLITSDHGNAEKMFSEKGGPHTAHTTARVPFIMTGSHKFIKLDDPGLADVAP
TVLDLMGLDIPADMTGKSLLKK
Download sequence
Identical sequences Sakowv30031826m XP_006820372.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]