SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30036040m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30036040m
Domain Number 1 Region: 17-162
Classification Level Classification E-value
Superfamily dUTPase-like 2.62e-46
Family dUTPase-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30036040m
Sequence length 164
Sequence
MQAVQYLQSSTPSKRLKLDMAMNVILKFVKLSENASAPLRGSKFAAGFDLFSAYDYTIKP
KDKVLAMTDIQIQLPDGCYGRVAPRSGLAVKHFIDVGAGVIDQDYRGNVGVVMFNFSESE
FEVKKGDRIAQLICEKIYMPELEECEKLDDSERGVGGFGSTGQK
Download sequence
Identical sequences Sakowv30036040m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]