SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30038746m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Sakowv30038746m
Domain Number - Region: 69-156
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0497
Family MgtE N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30038746m
Sequence length 188
Sequence
MRNPDPGTWANFTKNPDPGTWANFTKNPDPGTWENFTRNPESGTWANFTKNPDPGTWENF
TRNPDPGTWANFTKNPDPGTWANFTRNPDPGSWANFTRNPDPGTWANFTKNPDPGTWANF
TRNPDPGTWANFTKNPDPGTLANFTRNPDPGTWANFTKNPDPGTWANFTRNRDPGIWANF
TRNRDPGT
Download sequence
Identical sequences Sakowv30038746m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]