SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30042586m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30042586m
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily EF-hand 2.47e-39
Family Calmodulin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30042586m
Sequence length 223
Sequence
MSGLKKKPEKQLTDLLCKETHFRREEIEKLIQIFKKLLIDTNKNDTLKQESLKLDRTIFR
DILHNTFHMTDDMLMDRVFRAFDKDSDSYICLQEWVKGLSVFLQGTVDEKTQYCFDVYDL
NSDGYISREEMFHMLKNSMVKQPTEEDPDEGIKDLVELTLKKMDHDHDGRLSYKDFKSSV
VIEPLLLEAFGQCLPDNKSKDAFVKTFSDCDGQQADTSKKGKK
Download sequence
Identical sequences XP_002741434.1.86028 Sakowv30042586m Sakowv30042587m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]