SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30042837m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30042837m
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily EF-hand 3.32e-51
Family Calmodulin-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30042837m
Sequence length 155
Sequence
MSSGLNDEDKAEFWEAFSLFDKNGDGTISIWELGTVMRSLGQNPTEDELQEMIKEVDEDG
NGEIDFEEFLTMMAKKLRDIDVDEEIREAFRVFDKDTNGYITAKELQYIMTTYGETLPED
EVREMLNQADIDGDGKINYEEFVKTMAIDSLLKKS
Download sequence
Identical sequences Sakowv30042837m XP_006819034.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]